![Immunocytochemistry/Immunofluorescence: Kv7.5 Antibody [NBP1-82861] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Kv7.5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82861-img0011.jpg "Immunocytochemistry/Immunofluorescence: Kv7.5 Antibody [NBP1-82861] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPL |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KCNQ5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Kv7.5 Antibody (NBP1-82861)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KCNQ5 |
![Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining in human cerebral cortex and pancreas tissues using anti-KCNQ5 antibody. Corresponding KCNQ5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Kv7.5-Antibody-Immunohistochemistry-Paraffin-NBP1-82861-img0010.jpg "Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining in human cerebral cortex and pancreas tissues using anti-KCNQ5 antibody. Corresponding KCNQ5 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/Kv7.5-Antibody-Immunohistochemistry-Paraffin-NBP1-82861-img0008.jpg "Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Kv7.5-Antibody-Immunohistochemistry-Paraffin-NBP1-82861-img0009.jpg "Immunohistochemistry-Paraffin: Kv7.5 Antibody [NBP1-82861] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")