![Immunocytochemistry/Immunofluorescence: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/KCC3-SLC12A6-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89282-img0005.jpg "Immunocytochemistry/Immunofluorescence: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cell line A-431 shows localization to cytosol & vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RVRFSSRESVPETSRSEPMSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDE |
| Predicted Species | Mouse (94%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC12A6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89282 | Applications | Species |
|---|---|---|
| Shiozaki A, Takemoto K, Ichikawa D et al. The K-Cl Cotransporter KCC3 as an Independent Prognostic Factor in Human Esophageal Squamous Cell Carcinoma. Biomed Res Int 2014-01-01 [PMID: 25110711] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for KCC3/SLC12A6 Antibody (NBP1-89282)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC12A6 |
![Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human Lymph node shows moderate membranous and cytoplasmic positivity in germinal and non-germinal center cells.](http://images.novusbio.com/fullsize/KCC3-SLC12A6-Antibody-Immunohistochemistry-Paraffin-NBP1-89282-img0011.jpg "Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human Lymph node shows moderate membranous and cytoplasmic positivity in germinal and non-germinal center cells.")
![Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/KCC3-SLC12A6-Antibody-Immunohistochemistry-Paraffin-NBP1-89282-img0007.jpg "Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/KCC3-SLC12A6-Antibody-Immunohistochemistry-Paraffin-NBP1-89282-img0009.jpg "Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/KCC3-SLC12A6-Antibody-Immunohistochemistry-Paraffin-NBP1-89282-img0010.jpg "Immunohistochemistry-Paraffin: KCC3/SLC12A6 Antibody [NBP1-89282] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Flow Cytometry KCC4/SLC12A7 Antibody (891526) [Unconjugated]](https://images.novusbio.com/images2/KCC4_MAB9030_Flow_Cytometry_19166.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")