IL-10R alpha Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IL10RA |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for IL-10R alpha Antibody
Background
The IL-10 receptor, IL-10R, is a member of the class II subgroup of the cytokine receptor family and exhibits structural similarity to the interferon receptor. IL-10R is expressed in B cells and T helper cells, as well as in LPS-induced mouse fibroblasts. Overall, mouse IL-10R and human IL-10R share 60% sequence identity at the protein level. Stimulation with IL-10 leads to tyrosine phosphorylation of JAK1 and Tyk2, but not JAK2 or JAK3. In addition to its role as an antagonist of IFN-gamma-mediated macrophage activation, IL-10Ralpha transmits differentiation as well as proliferative signals. IL-10R is constitutively expressed on human natural killer (NK) cells and the direct binding of IL-10 potentiates cytokine production by human NK cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for IL-10R alpha Antibody (NBP3-21308) (0)
There are no publications for IL-10R alpha Antibody (NBP3-21308).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-10R alpha Antibody (NBP3-21308) (0)
There are no reviews for IL-10R alpha Antibody (NBP3-21308).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-10R alpha Antibody (NBP3-21308) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-10R alpha Products
Research Areas for IL-10R alpha Antibody (NBP3-21308)
Find related products by research area.
|
Blogs on IL-10R alpha