![Western Blot: IGBP1 Antibody [NBP1-83126] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18, Lane 2: Human cell line RT-4, Lane 3: Human cell line EFO-21, Lane 4: Human cell line A-431](http://images.novusbio.com/fullsize/IGBP1-Antibody-Western-Blot-NBP1-83126-img0006.jpg "Western Blot: IGBP1 Antibody [NBP1-83126] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18, Lane 2: Human cell line RT-4, Lane 3: Human cell line EFO-21, Lane 4: Human cell line A-431")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IGBP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83126 | Applications | Species |
|---|---|---|
| Chen W, Pilling D, Gomer RH The mRNA binding protein DDX3 mediates TGF-?1 upregulation of translation and promotes pulmonary fibrosis JCI insight 2023-02-23 [PMID: 36821384] (IHC-Fr, WB, Mouse, Human) | IHC-Fr, WB | Mouse, Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for IGBP1 Antibody (NBP1-83126)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IGBP1 |
![Immunocytochemistry/Immunofluorescence: IGBP1 Antibody [NBP1-83126] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.](http://images.novusbio.com/fullsize/IGBP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83126-img0007.jpg "Immunocytochemistry/Immunofluorescence: IGBP1 Antibody [NBP1-83126] - Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules.")
![Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/IGBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83126-img0010.jpg "Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IGBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83126-img0008.jpg "Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/IGBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83126-img0009.jpg "Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/IGBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83126-img0011.jpg "Immunohistochemistry-Paraffin: IGBP1 Antibody [NBP1-83126] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]](https://images.novusbio.com/images2/PP2A_AF3989_Western_Blot_5373.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![MAdCAM-1 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "MAdCAM-1 [Unconjugated]")
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")