![Western Blot: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 expression in transfected 293T cell line by HOXD1 monoclonal antibody (M01), clone 4F4.Lane 1: HOXD1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/HOXD1-Antibody-4F4-Western-Blot-H00003231-M01-img0003.jpg "Western Blot: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 expression in transfected 293T cell line by HOXD1 monoclonal antibody (M01), clone 4F4.Lane 1: HOXD1 transfected lysate(34.1 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IP |
| Clone | 4F4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | HOXD1 (NP_078777, 151 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ |
| Specificity | HOXD1 - homeobox D1 (4F4) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HOXD1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunoprecipitation: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 transfected lysate using anti-HOXD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXD1 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/HOXD1-Antibody-4F4-Immunoprecipitation-H00003231-M01-img0001.jpg "Immunoprecipitation: HOXD1 Antibody (4F4) [H00003231-M01] - Analysis of HOXD1 transfected lysate using anti-HOXD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HOXD1 MaxPab rabbit polyclonal antibody.")
![Sandwich ELISA: HOXD1 Antibody (4F4) [H00003231-M01] - Detection limit for recombinant GST tagged HOXD1 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/HOXD1-Antibody-4F4-Sandwich-ELISA-H00003231-M01-img0002.jpg "Sandwich ELISA: HOXD1 Antibody (4F4) [H00003231-M01] - Detection limit for recombinant GST tagged HOXD1 is 0.1 ng/ml as a capture antibody.")
