![Immunocytochemistry/Immunofluorescence: HLA DQB2 Antibody [NBP3-17054] - Analysis in human skin and colon tissues using Anti-HLA-DQB2 antibody. Corresponding HLA-DQB2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HLA-DQB2-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-17054-img0003.jpg "Immunocytochemistry/Immunofluorescence: HLA DQB2 Antibody [NBP3-17054] - Analysis in human skin and colon tissues using Anti-HLA-DQB2 antibody. Corresponding HLA-DQB2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HLA-DQB2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for HLA DQB2 Antibody (NBP3-17054)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HLA-DQB2 |
![Immunohistochemistry-Paraffin: HLA DQB2 Antibody [NBP3-17054] - Staining of human skin shows high expression.](http://images.novusbio.com/fullsize/HLA-DQB2-Antibody-Immunohistochemistry-Paraffin-NBP3-17054-img0002.jpg "Immunohistochemistry-Paraffin: HLA DQB2 Antibody [NBP3-17054] - Staining of human skin shows high expression.")
![Immunohistochemistry-Paraffin: HLA DQB2 Antibody [NBP3-17054] - Staining of human colon shows low expression as expected.](http://images.novusbio.com/fullsize/HLA-DQB2-Antibody-Immunohistochemistry-Paraffin-NBP3-17054-img0001.jpg "Immunohistochemistry-Paraffin: HLA DQB2 Antibody [NBP3-17054] - Staining of human colon shows low expression as expected.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD2_AF2247_Immunohistochemistry_20053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")