![Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human colon, kidney, liver and testis using Anti-GCC1 antibody NBP1-83609 (A) shows similar protein distribution across tissues to independent antibody NBP1-83610 (B).](http://images.novusbio.com/fullsize/GCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83609-img0010.jpg "Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human colon, kidney, liver and testis using Anti-GCC1 antibody NBP1-83609 (A) shows similar protein distribution across tissues to independent antibody NBP1-83610 (B).")
| Reactivity | Hu, Mu, Rt, CaSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GCC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83609 | Applications | Species |
|---|---|---|
| Wong M, Munro S. The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins. Science 2014-10-31 [PMID: 25359980] (ICC/IF, Human) | ICC/IF | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Heike Folsch |
IF | Canine | 07/27/2012 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: GCC1 Antibody [NBP1-83609] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/GCC1-Antibody-Western-Blot-NBP1-83609-img0016.jpg "Western Blot: GCC1 Antibody [NBP1-83609] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: GCC1 Antibody [NBP1-83609] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/GCC1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83609-img0009.jpg "Immunocytochemistry/Immunofluorescence: GCC1 Antibody [NBP1-83609] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human kidney.](http://images.novusbio.com/fullsize/GCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83609-img0014.jpg "Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human kidney.")
![Western Blot: GCC1 Antibody [NBP1-83609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/GCC1-Antibody-Western-Blot-NBP1-83609-img0015.jpg "Western Blot: GCC1 Antibody [NBP1-83609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human testis.](http://images.novusbio.com/fullsize/GCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83609-img0011.jpg "Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human testis.")
![Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human liver.](http://images.novusbio.com/fullsize/GCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83609-img0012.jpg "Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human liver.")
![Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human colon.](http://images.novusbio.com/fullsize/GCC1-Antibody-Immunohistochemistry-Paraffin-NBP1-83609-img0013.jpg "Immunohistochemistry-Paraffin: GCC1 Antibody [NBP1-83609] - Staining of human colon.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
