dynein, cytoplasmic 2, light intermediate chain 1 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human dynein, cytoplasmic 2, light intermediate chain 1. Peptide sequence: SPMELWKKVYEKLFPPKSINTLKDIKDPARDPQYAENEVDEMRIQKDLEL The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DYNC2LI1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for dynein, cytoplasmic 2, light intermediate chain 1 Antibody
Background
dynein, cytoplasmic 2, light intermediate chain 1 may function as a motor for intraflagellar retrograde transport. Functions in cilia biogenesis (By similarity)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Ze
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945) (0)
There are no publications for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945) (0)
There are no reviews for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional dynein, cytoplasmic 2, light intermediate chain 1 Products
Research Areas for dynein, cytoplasmic 2, light intermediate chain 1 Antibody (NBP2-82945)
Find related products by research area.
|
Blogs on dynein, cytoplasmic 2, light intermediate chain 1