Home » Cystatin F » Cystatin F Proteins » Cystatin F Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Cystatin F Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Cystatin F Protein (NBP2-13881PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Cystatin F Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CST7.

Source: E. coli

Amino Acid Sequence: VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CST7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13881.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cystatin F Recombinant Protein Antigen

  • CMAP
  • CST7
  • Cystatin 7
  • cystatin F (leukocystatin)
  • Cystatin F
  • Cystatin-7
  • cystatin-F
  • Cystatin-like metastasis-associated protein
  • Leukocystatin

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(20 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ALS Antibody
[Unconjugated]
AF1436
Western Blot ALS Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Mu
Applications: WB
Adrenomedullin/ADM
Antibody [Unconjugate ...
AF6108
Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
Cathepsin L
Antibody [Unconjugate
AF952
Western Blot Cathepsin L Antibody [Unconjugated]
Immunohistochemistry Cathepsin L Antibody [Unconjugated]
Western Blot Cathepsin L Antibody [Unconjugated]
(27 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Neurolysin
Antibody (OTI1D6) - A ...
NBP2-72961
Western Blot Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Western Blot Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Flow Cytometry Neurolysin Antibody (OTI1D6) - Azide and BSA Free
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ASC/TMS1 Antibody
- BSA Free
NBP1-78977
Immunocytochemistry/ Immunofluorescence ASC/TMS1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ASC/TMS1 Antibody - BSA Free
Immunohistochemistry ASC/TMS1 Antibody - BSA Free
(2 Reviews)
(49 Publications)
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot GRIP1 Antibody - BSA Free
Immunohistochemistry GRIP1 Antibody - BSA Free
Immunohistochemistry GRIP1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PMP22 Antibody
(Hu1) - Azide and BSA ...
NBP2-80913
Immunohistochemistry PMP22 Antibody (Hu1) - Azide and BSA Free
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
EDAR Antibody
[Unconjugated]
AF745
EDAR Antibody [Unconjugated]
(6 Publications)
Species: Mu
Applications: Block, WB
Cystatin E/M/CST6
Antibody [Unconjugate ...
AF1286
Western Blot Cystatin E/M/CST6 Antibody [Unconjugated]
Simple Western Cystatin E/M/CST6 Antibody [Unconjugated]
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, IP, Simple Western, WB
Cystatin C [HRP]
MSCTC0
N/A Cystatin C [HRP]
N/A Cystatin C [HRP]
N/A Cystatin C [HRP]
(35 Publications)
Species: Mu, Rt
Applications: ELISA
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/ Immunofluorescence Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Western Blot Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Cystatin F
Recombinant Protein A
NBP2-13881PEP
Cystatin F Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Cystatin F Protein (NBP2-13881PEP) (0)

There are no publications for Cystatin F Protein (NBP2-13881PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin F Protein (NBP2-13881PEP) (0)

There are no reviews for Cystatin F Protein (NBP2-13881PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cystatin F Protein (NBP2-13881PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cystatin F Products

Research Areas for Cystatin F Protein (NBP2-13881PEP)

Find related products by research area.

Blogs on Cystatin F

There are no specific blogs for Cystatin F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: ASC/TMS1 Antibody [NBP1-78977] - Tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
ASC/TMS1 Antibody - BSA Free
NBP1-78977

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cystatin F Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CST7