![Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat](http://images.novusbio.com/fullsize/Connexin-36-GJD2-Antibody-Western-Blot-NBP1-59254-img0006.jpg "Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to GJD2(gap junction protein, delta 2, 36kDa) The peptide sequence was selected from the middle region of GJD2. Peptide sequence ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GJD2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25197082). Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 30412665). |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Connexin 36/GJD2 Antibody (NBP1-59254)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody NBP1-59254 was used at a concentration of 1ug/mL (along with Parvalbumin antibody for double staining) with gentle shaking and overnight incubation at 4C. For the detection of NBP1-59254 primary, anti-rabbit Alexa 555 secondary was employed and images were captured using a confocal microscope at 63X resolution.](http://images.novusbio.com/fullsize/Connexin-36-GJD2-Antibody-Immunohistochemistry-Frozen-NBP1-59254-img0007.jpg "Immunohistochemistry: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody NBP1-59254 was used at a concentration of 1ug/mL (along with Parvalbumin antibody for double staining) with gentle shaking and overnight incubation at 4C. For the detection of NBP1-59254 primary, anti-rabbit Alexa 555 secondary was employed and images were captured using a confocal microscope at 63X resolution.")
![Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/Connexin-36-GJD2-Antibody-Western-Blot-NBP1-59254-img0005.jpg "Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")