![Western Blot: CDC45L Antibody [NBP1-85723] - Analysis in control (vector only transfected HEK293T lysate) and CDC45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CDC45L-Antibody-Western-Blot-NBP1-85723-img0013.jpg "Western Blot: CDC45L Antibody [NBP1-85723] - Analysis in control (vector only transfected HEK293T lysate) and CDC45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MFVSDFRKEFYEVVQSQRVLLFVASDVDALCACKILQALFQCDHVQYTLVPVSGWQELETAFLEHKEQFHYFILINCGANVDLLDILQPDEDTIFFVCDTHRPVNVVNVYNDTQIKLLIKQDDDLEVPAYEDIFRDEEEDEEHSGNDSDGSEPSEKRTRL |
| Predicted Species | Mouse (91%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDC45 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDC45L Antibody (NBP1-85723)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDC45 |
![Immunocytochemistry/Immunofluorescence: CDC45L Antibody [NBP1-85723] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CDC45L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85723-img0005.jpg "Immunocytochemistry/Immunofluorescence: CDC45L Antibody [NBP1-85723] - Staining of human cell line A-431 shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining in human testis and endometrium tissues using anti-CDC45 antibody. Corresponding CDC45 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CDC45L-Antibody-Immunohistochemistry-Paraffin-NBP1-85723-img0012.jpg "Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining in human testis and endometrium tissues using anti-CDC45 antibody. Corresponding CDC45 RNA-seq data are presented for the same tissues.")
![Western Blot: CDC45L Antibody [NBP1-85723] - Analysis in human cell line K562.](http://images.novusbio.com/fullsize/CDC45L-Antibody-Western-Blot-NBP1-85723-img0008.jpg "Western Blot: CDC45L Antibody [NBP1-85723] - Analysis in human cell line K562.")
![Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/CDC45L-Antibody-Immunohistochemistry-Paraffin-NBP1-85723-img0010.jpg "Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/CDC45L-Antibody-Immunohistochemistry-Paraffin-NBP1-85723-img0011.jpg "Immunohistochemistry-Paraffin: CDC45L Antibody [NBP1-85723] - Staining of human testis shows high expression.")
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")