Home » CD90/Thy1 » CD90/Thy1 Proteins » CD90/Thy1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD90/Thy1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CD90/Thy1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD90/Thy1.

Source: E. coli

Amino Acid Sequence: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THY1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52961.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD90/Thy1 Recombinant Protein Antigen

  • CD90 antigen
  • CD90
  • CDw90
  • FLJ33325
  • Thy-1 antigen
  • Thy-1 cell surface antigen
  • thy-1 membrane glycoprotein
  • Thy-1 T-cell antigen
  • Thy1

Background

CD90 (Thy1) antigen is a GPI linked glycoprotein member of the Immunoglobulin superfamily. It is expressed on murine T cells, thymocytes, neural cells, cells of granulocytic lineage, early hematopoietic progenitors, fibroblasts, neurons and Kupffer's cells. Thy1 may play a role in cell to cell or cell to ligand interactions during synaptogenesis and other events in the brain. It is found in most mouse strains except AKR/J, A, Thy1.1 and B6.PL (74NS) expressing Thy1.1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
Endoglin/CD105
Antibody [Unconjugate
AF1320
Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]
Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]
Simple Western Endoglin/CD105 Antibody [Unconjugated]
(2 Reviews)
(42 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(63 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
(32 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Musculin Antibody
(1D1)
H00009242-M01
Western Blot Musculin Antibody (1D1)
(1 Review)
Species: Hu
Applications: ELISA, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(110 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
ALCAM/CD166
Antibody [Unconjugate
AF1172
Immunohistochemistry ALCAM/CD166 Antibody [Unconjugated]
Immunocytochemistry ALCAM/CD166 Antibody [Unconjugated]
Western Blot ALCAM/CD166 Antibody [Unconjugated]
(2 Reviews)
(22 Publications)
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
CD31/PECAM-1
Antibody [Unconjugate
AF3628
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]
Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]
(6 Reviews)
(468 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Hemoglobin alpha
Antibody - BSA Free
NB110-41083
Hemoglobin alpha Antibody - BSA Free
(12 Publications)
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
CD133 Antibody -
BSA Free
NB120-16518
Immunohistochemistry-Paraffin CD133 Antibody - BSA Free
Western Blot CD133 Antibody - BSA Free
Chromatin Immunoprecipitation CD133 Antibody - BSA Free
(37 Publications)
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(73 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
CD14 [HRP]
DC140
N/A CD14 [HRP]
N/A CD14 [HRP]
(136 Publications)
Species: Hu
Applications: ELISA
NDUFA2 Antibody -
BSA Free
NBP2-93743
Immunocytochemistry/ Immunofluorescence NDUFA2 Antibody - BSA Free
Western Blot NDUFA2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Aminopeptidase
N/CD13 Antibody [Unco ...
AF2335
Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]
(53 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
CD90/Thy1
Recombinant Protein A
NBP2-52961PEP
CD90/Thy1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP) (0)

There are no publications for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP) (0)

There are no reviews for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP). (Showing 1 - 1 of 1 FAQ).

  1. We are interested in CD90 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
    • I would recommend one of theses <a href="http://www.novusbio.com/productsearch/CD90%252FThy1#fq=common_name%3A%22CD90%2FThy1%22&fq=species%3A%22Canine%22" target="_self">CD90 antibodies</a>, as these have all been validated for use with dog/canine samples.

Additional CD90/Thy1 Products

Research Areas for CD90/Thy1 Recombinant Protein Antigen (NBP2-52961PEP)

Find related products by research area.

Blogs on CD90/Thy1.

Check out the latest blog posts on CD90/Thy1.
CD90 (Cluster of differentiation 90)
CD90 is a 25-35kD glycosylphosphatidylinositol (GPI)-linked glycoprotein receptor of the immunoglobulin (Ig) superfamily. It is found on murine T-cells, thymocytes, neuronal cells, granulocytic lineage-derived cells, hematopoietic stem cells, fibrobla...  Read full blog post.
How New Oval Stem Cell Marker Antibodies Will Benefit Hepatic Research
A large number of antibody suppliers supply conjugated and non-conjugated marker antibodies, targeted at specific stem cell populations. Until recently the number of oval stem cell markers was extremely limited. However, we at Novus Biologicals have s...  Read full blog post.

Customers Who Bought This Also Bought

CD31/PECAM-1 was detected in immersion fixed frozen sections of mouse embryo (E13.5) using Goat Anti-Human/Mouse/Rat CD31/PECAM-1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3628) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights&#8482; 557-conjugated Anti-Goat IgG Secondary Antibody (yellow; NL001) and counterstained with DAPI (blue). Specific staining was localized to developing endothelium. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
CD31/PECAM-1 Antibody [Unconjugated]
AF3628
Human mesenchymal stem cells were stained with Sheep Anti-Human/Porcine/Canine CD90/Thy1 Antigen Affinity-purified Polyclonal Antibody (Catalog&nbsp;# AF2067, filled histogram) or isotype control antibody (Catalog&nbsp;# 5-001-A, open histogram), followed by PE-conjugated Anti-Sheep IgG Secondary Antibody (Catalog&nbsp;# F0126).
CD90/Thy1 Antibody
AF2067

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD90/Thy1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol THY1