Novus Biologicals products are now on bio-techne.com

Caspase 5 Recombinant Protein Antigen

Images

 
There are currently no images for Caspase 5 Protein (NBP1-87682PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Caspase 5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CASP5.

Source: E. coli

Amino Acid Sequence: VEGVFIFLIEDSGKKKRRKNFEAMFKGILQSGLDNFVINHMLKNNVAGQTSIQTLVPNTDQKSTSVKKDNHKKKTVKMLEYLGKDV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CASP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87682.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Caspase 5 Recombinant Protein Antigen

  • CASP5
  • CASP-5
  • caspase 5, apoptosis-related cysteine peptidase
  • caspase 5, apoptosis-related cysteine protease
  • Caspase5
  • Caspase-5
  • EC 3.4.22
  • EC 3.4.22.58
  • ICE(rel)III
  • ICE(rel)-III
  • ICEREL-III
  • ICH3
  • ICH-3
  • MGC141966
  • Protease ICH-3
  • Protease TY
  • TY protease

Background

Caspases are a family of cytosolic aspartate-specific cysteine proteases involved in the initiation and execution of apoptosis. Caspase-5 (ICH-3, ICEREL-III, TY protease) is a member of the caspase-1 subfamily and it is an upstream mediator of apoptosis. Caspase-5 is highly expressed in lung, liver, and skeletal muscle, and similar to Caspase-4, its overexpression can induce cellular apoptosis (1). A tetramer, Caspase-5 separates into two subunits of a 20kda (p20) and 10kda (p10) after activation. In vitro, Caspase-5 can be cleaved by GranB, a major player in Cytotoxic T lymphocytes (CTL) induced apoptosis (2). In vivo, the Caspase-5 expression is elevated by LPS and IFNg. Caspase-5 induced apoptosis can be inhibited by CrmA and Bcl-2. Caspase-5 has also been implicated in cellular inflammatory response and in the microsatelite mutator pathway for cancer (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB120-10454
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, MiAr, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
H00010491-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB100-1002
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56114
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
NBP1-54899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-56529
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for Caspase 5 Protein (NBP1-87682PEP) (0)

There are no publications for Caspase 5 Protein (NBP1-87682PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase 5 Protein (NBP1-87682PEP) (0)

There are no reviews for Caspase 5 Protein (NBP1-87682PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Caspase 5 Protein (NBP1-87682PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caspase 5 Products

Research Areas for Caspase 5 Protein (NBP1-87682PEP)

Find related products by research area.

Blogs on Caspase 5.

CARD & NFKB Antibodies for Apoptosis Research
Apoptosis is one of the main types of programmed cell death which involves a cascade of biochemical events leading to specific cell morphology characteristics and ultimately death of cells.Caspases play crucial roles in modulating cellular signaling...  Read full blog post.

Caspase Antibodies as Cancer Biomarkers
We at Novus Biologicals are one of the leading antibody suppliers for products targeted to apoptosis. These products are regularly used by cancer research groups - apoptosis is fundamental to developing therapies that will kill tumor cells. Caspase pr...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Caspase 5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP5