Novus Biologicals products are now on bio-techne.com

CAMKID Recombinant Protein Antigen

Name: CAMKID Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-85589PEP
Price: 279 USD

Images

There are currently no images for CAMKID Protein (NBP1-85589PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CAMKID Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CAMK1D. Source: E. coli Amino Acid Sequence: MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CAMK1D
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85589. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CAMKID Recombinant Protein Antigen

calcium/calmodulin-dependent protein kinase ID
calcium/calmodulin-dependent protein kinase type 1D
CaM kinase I delta
CaM kinase ID
CaM-K1
CaMKI delta
CaM-KI delta
CaMKID
CaMKI-like protein kinase
CKLiKEC 2.7.11.17
EC 2.7.11

Background

CAMK1D encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDC123 Antibody
(OTI1F8)

NBP2-45600

Immunohistochemistry CDC123 Antibody (OTI1F8)

Species: Ca, Hu, Pm, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

JAZF1 Antibody
(PCRP-JAZF1-1C2)

NBP3-13885

Immunocytochemistry/ Immunofluorescence JAZF1 Antibody (PCRP-JAZF1-1C2)

Immunohistochemistry-Paraffin JAZF1 Antibody (PCRP-JAZF1-1C2)

Species: Hu

Applications: Flow, ICC/IF, IHC-P, IP, PA, WB

TSPAN8/TM4SF3
Antibody (458811) [Un ...

MAB4734

Flow Cytometry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]

Immunocytochemistry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]

(4 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, WB

ADAMTS9 Antibody

NBP1-82916

Immunohistochemistry-Paraffin ADAMTS9 Antibody

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

Notch-2 Antibody
[Unconjugated]

AF3735

(6 Publications)

Species: Hu

Applications: IHC, WB

THADA Antibody -
BSA Free

NBP2-93002

Immunocytochemistry/ Immunofluorescence THADA Antibody - BSA Free

Species: Hu, Mu

Applications: ICC/IF, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

CaM Kinase I
Antibody

AF7899

Species: Hu

Applications: IHC, WB

Lgr5/GPR49
Antibody - BSA Free

NBP1-28904

Immunocytochemistry/ Immunofluorescence Lgr5/GPR49 Antibody - BSA Free

(1 Review)

(11 Publications)

Species: Hu, Mu, Po

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

VEGF [HRP]

DVE00

(679 Publications)

Species: Hu

Applications: ELISA

Progesterone
R/NR3C3 Antibody [Unc ...

AF5415

Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]

Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]

(2 Publications)

Species: Hu

Applications: ICC, IHC, Simple Western, WB

CD34 Antibody (MEC
14.7)

NB600-1071

Immunocytochemistry/ Immunofluorescence CD34 Antibody (MEC 14.7)

(29 Publications)

Species: Hu(-), Mu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Dermcidin Antibody
(G-81)

NBP1-49620

(2 Publications)

Species: Hu

Applications: IA, ICC/IF, IHC, IHC-P, WB

NDUFB6 Antibody

NBP1-92172

Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

HHEX Antibody (1A5)

H00003087-M02

Immunocytochemistry/ Immunofluorescence HHEX Antibody (1A5)

Species: Hu

Applications: ELISA, ICC/IF, S-ELISA, WB

Ctip1 Antibody

NB600-261

(1 Review)

(10 Publications)

Species: Hu, Mu

Applications: ChIP, Flow, GS, IP, WB

AKR1C2 Antibody
(CPTC-AKR1C2-1)

NBP2-79775

Protein Array AKR1C2 Antibody (CPTC-AKR1C2-1)

Species: Hu

Applications: IHC, IHC-P, PA, WB

ZnT-8/SLC30A8
Antibody (815039) [Un ...

MAB7936

Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]

Species: Hu

Applications: CyTOF-ready, IHC, ICFlow

Calmodulin 2
Antibody

NBP2-14871

(1 Publication)

Species: Mu, Rt

Applications: ICC/IF, WB

Calmodulin
Antibody (2D1) - BSA

NB120-2860

(3 Publications)

Species: Ba, Bv, Ch, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for CAMKID Protein (NBP1-85589PEP) (0)

There are no publications for CAMKID Protein (NBP1-85589PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAMKID Protein (NBP1-85589PEP) (0)

There are no reviews for CAMKID Protein (NBP1-85589PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CAMKID Protein (NBP1-85589PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CAMKID Products

Research Areas for CAMKID Protein (NBP1-85589PEP)

Find related products by research area.

Blogs on CAMKID

There are no specific blogs for CAMKID, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

CD34 was detected in perfusion fixed frozen sections of rat liver using 15 µg/mL Rat CD34 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4117) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.

CD34 Antibody [Unconjugated]
AF4117

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our CAMKID Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

CAMK1D

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

CAMKID Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

CAMKID Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for CAMKID Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CAMKID Protein (NBP1-85589PEP) (0)

Reviews for CAMKID Protein (NBP1-85589PEP) (0)

FAQs for CAMKID Protein (NBP1-85589PEP) (0)

Additional CAMKID Products

Research Areas for CAMKID Protein (NBP1-85589PEP)

Blogs on CAMKID

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics