![Western Blot: CAMKID Antibody [NBP1-85589] - Analysis in control (vector only transfected HEK293T lysate) and CAMK1D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CAMKID-Antibody-Western-Blot-NBP1-85589-img0011.jpg "Western Blot: CAMKID Antibody [NBP1-85589] - Analysis in control (vector only transfected HEK293T lysate) and CAMK1D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG |
| Predicted Species | Mouse (100%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CAMK1D |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Immunohistochemistry_12988.jpg)
![Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Flow_Cytometry_23901.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CAMKID Antibody (NBP1-85589)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CAMK1D |
![Immunocytochemistry/Immunofluorescence: CAMKID Antibody [NBP1-85589] - Staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CAMKID-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85589-img0010.jpg "Immunocytochemistry/Immunofluorescence: CAMKID Antibody [NBP1-85589] - Staining of human cell line U-251 MG shows localization to nucleus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/CAMKID-Antibody-Immunohistochemistry-Paraffin-NBP1-85589-img0015.jpg "Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Analysis in human cerebral cortex and liver tissues. Corresponding CAMK1D RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CAMKID-Antibody-Immunohistochemistry-Paraffin-NBP1-85589-img0012.jpg "Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Analysis in human cerebral cortex and liver tissues. Corresponding CAMK1D RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in endothelial cells.](http://images.novusbio.com/fullsize/CAMKID-Antibody-Immunohistochemistry-Paraffin-NBP1-85589-img0013.jpg "Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in endothelial cells.")
![Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/CAMKID-Antibody-Immunohistochemistry-Paraffin-NBP1-85589-img0014.jpg "Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CAMKID-Antibody-Immunohistochemistry-Paraffin-NBP1-85589-img0016.jpg "Immunohistochemistry-Paraffin: CAMKID Antibody [NBP1-85589] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Western_Blot_11031.jpg)
![Flow Cytometry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Flow_Cytometry_8501.jpg)
![Immunocytochemistry TSPAN8/TM4SF3 Antibody (458811) [Unconjugated]](https://images.novusbio.com/images2/TSPAN8_MAB4734_Immunocytochemistry_9894.jpg)
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")