I would like to buy antibodies APOA4 (apolipoprotein AIV) for the cows (to western blot). I know that You don't have the antibodies for this species. Could You propose the best atibodies which I could test (use) in my experiment?

Name: Apolipoprotein A-IV/ApoA4 Antibody (CL0465)
Brand: Novus Biologicals
SKU: NBP2-52930
Price: 519 USD

Question

Accepted Answer

All eight of our APOA4 antibodies were raised against the human protein, and all of them have currently only been tested against human samples. I ran an alignment for you and found that there is a 77% sequence homology between human and bovine APOA4, so it is possible that the antibodies raised against human APOA4 may recognise the bovine protein. Should you wish to try any of our antibodies with your samples, you may be interested in our Innovator's Reward Program, which allows you to try our primary antibodies in an untested species or application without the financial risk of failure. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, IHC
Clone	CL0465
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Epitope	LRQRLAPLAEDVRGN
Isotype	IgG2a
Clonality	Monoclonal
Host	Mouse
Gene	APOA4
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Protein A purified

Apolipoprotein A-IV/ApoA4 Antibody (CL0465)

Species Glossary

Images

Product Details

Order Details

Apolipoprotein A-IV/ApoA4 Antibody (CL0465) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Apolipoprotein A-IV/ApoA4 Antibody (CL0465)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52930) (0)

Reviews for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52930) (0)

Product General Protocols

Video Protocols

FAQs for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52930). (Showing 1 - 1 of 1 FAQ).

Secondary Antibodies

Isotype Controls

Additional Apolipoprotein A-IV/ApoA4 Products

Research Areas for Apolipoprotein A-IV/ApoA4 Antibody (NBP2-52930)

Blogs on Apolipoprotein A-IV/ApoA4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics