Als2 Antibody Summary
Immunogen |
This antibody has been engineered to specifically recognize the recombinant protein Als2 using the following amino acid sequence: LGFWKTFPGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAEPLSEEAGGVN |
Predicted Species |
Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ALS2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
|
Application Notes |
For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Als2 Antibody
Background
Defects in ALS2, or Alsin, are the cause of amyotrophic lateral sclerosis 2 (ALS2), juvenile primary lateral sclerosis (JPLS), and infantile-onset ascending spastic paralysis (IAHSP). ALS2 is a neurodegenerative disorder which is closely related to but clinically distinct from juvenile primary lateral sclerosis. It is a progressive paralytic disorder which results from dysfunction of the motor systems comprising the upper motor neurons of the motor cortex and lower motor neurons of the brain stem and spinal cord. JPLS is a neurodegenerative disorder which is closely related to but clinically distinct from amyotrophic lateral sclerosis. It is a progressive paralytic disorder which results from dysfunction of the upper motor neurons of the motor cortex while the lower neurons are unaffected. IAHSP is characterized by progressive spasticity and weakness of limbs.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for Als2 Antibody (NBP3-25273) (0)
There are no publications for Als2 Antibody (NBP3-25273).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Als2 Antibody (NBP3-25273) (0)
There are no reviews for Als2 Antibody (NBP3-25273).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Als2 Antibody (NBP3-25273) (0)