| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 803-902 of Human ALDH1L1 Source: Wheat Germ (in vitro) Amino Acid Sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | ALDH1L1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Research Areas for ALDH1L1 Partial Recombinant Protein (H00010840-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALDH1L1 |
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Immunocytochemistry/Immunofluorescence: ALDH1L1 Antibody (2E7) [NBP2-50033] - Analysis of cortical neuron-glial cell culture from E20 rat stained with mouse mAb to aldehyde dehydrogenase 1L1 (ALDH1L1), NBP2-50033, dilution 1:1,000 in red, and costained with chicken pAb to GFAP, dilution 1:5,000 in green. The blue is Hoechst staining of nuclear DNA. NBP2-50033 antibody produces cytoplasmic staining of glial cells, while the GFAP antibody labels the intermediate filament cytoskeleton in astrocytes and other glial cells. Some astrocytic cells express both ALDH1L1 and GFAP and appear yellow.](https://images.novusbio.com/images/ALDH1L1-Antibody-2E7-Immunocytochemistry-Immunofluorescence-NBP2-50033-img0002.jpg "Immunocytochemistry/Immunofluorescence: ALDH1L1 Antibody (2E7) [NBP2-50033] - Analysis of cortical neuron-glial cell culture from E20 rat stained with mouse mAb to aldehyde dehydrogenase 1L1 (ALDH1L1), NBP2-50033, dilution 1:1,000 in red, and costained with chicken pAb to GFAP, dilution 1:5,000 in green. The blue is Hoechst staining of nuclear DNA. NBP2-50033 antibody produces cytoplasmic staining of glial cells, while the GFAP antibody labels the intermediate filament cytoskeleton in astrocytes and other glial cells. Some astrocytic cells express both ALDH1L1 and GFAP and appear yellow.")