ABCG2/CD338 Antibody (2K8X1) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG2/CD338 (Q9UNQ0). SGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
ABCG2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
72 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for ABCG2/CD338 Antibody (2K8X1)
Background
Tumor cells may display a multidrug resistant phenotype by overexpression of ATP-binding cassette transporters such as multidrug resistance (MDRI) p-glycoprotein, multidrug resistance protein 1 (MRP1), and breast cancer resistance protein (BCRP). Tumor cells can be intrinsically resistant to drugs or they can acquire resistance to structurally and functionally unrelated drugs on drug exposure. This phenomenon is known as multidrug resistance (MDR). In human tumor cells, several transporter proteins can be involved in MDR. These proteins, MDR1 P-gp (ABCB1), MRP1 (ABCC1), MRP2 (ABCC2), MRP3 (ABCC3), and BCRP (ABCG2), belong to the ABC transporter family. They act as efflux pumps, which result in decreased intracellular concentrations of cytotoxic drugs. BCRP is a recently discovered half-transporter that probably acts as a homo- or heterodimer in transporting cytotoxic agents. The transporter molecule is capable of transporting several anticancer drugs but has thus far been found mainly in MX-resistant cell lines.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA
Publications for ABCG2/CD338 Antibody (NBP3-15559) (0)
There are no publications for ABCG2/CD338 Antibody (NBP3-15559).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ABCG2/CD338 Antibody (NBP3-15559) (0)
There are no reviews for ABCG2/CD338 Antibody (NBP3-15559).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ABCG2/CD338 Antibody (NBP3-15559) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ABCG2/CD338 Products
Research Areas for ABCG2/CD338 Antibody (NBP3-15559)
Find related products by research area.
|
Blogs on ABCG2/CD338