Reactivity | HuSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a Recombinant Protein corresponding to amino acids: EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ABCG1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Theoretical MW | 75.59 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
Control |
|
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 08/15/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ABCG1 Antibody (NBP2-54682)Find related products by research area.
|
ABCA1 (ATP-binding cassette transporter A1) The ABCA1 molecule is a primary gatekeeper for regulating the intracellular transport of cholesterol. It belongs to a larger related multifamily of cAMP-dependent anion transporter cell membrane molecules. These key proteins are responsible for tr... Read full blog post. |
ABCA1 - The Caretaker for Cholesterol Transportation The ATP-binding cassette transporter A1 (ABCA1) protein is a key gatekeeper for regulating intracellular cholesterol transport. It is one member of a large family of genes comprised of cAMP-dependent anion transporter cell membrane proteins. These imp... Read full blog post. |
ABCG1: Easy as 123 ABCG1 (ATP-binding cassette sub-family G member 1) is a transporter protein that is primarily involved in macrophage lipid homeostasis. It is a member of the superfamily of ATP-binding cassette (ABC) transporters and localizes to intracellular compart... Read full blog post. |
ABCG2: A Tumor Protector ABCG2 is a member of the ATP-binding cassette (ABC) transporter superfamily. Among ABC transporters ABCG2 is particularly interesting for its potential role in protecting cancer stem cells and its complex oligomeric structure (1). The ABC transporters... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ABCG1 |