![Western Blot: AASDH Antibody [H00132949-B01P] - Analysis of AASDH expression in transfected 293T cell line by AASDH polyclonal antibody. Lane 1: AASDH transfected lysate(14.74 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/AASDH-Antibody-Western-Blot-H00132949-B01P-img0002.jpg "Western Blot: AASDH Antibody [H00132949-B01P] - Analysis of AASDH expression in transfected 293T cell line by AASDH polyclonal antibody. Lane 1: AASDH transfected lysate(14.74 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | AASDH (AAH15096, 1 a.a. - 134 a.a.) full-length human protein. MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIREIGLYCQPGIDLPSWILGILQVPAAYVPIEPDSPPSLSTHFMKKCNLKYILVEKKQINVSLDVSIVFCLYYIYFN |
| Specificity | AASDH - 2-aminoadipic 6-semialdehyde dehydrogenase, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | AASDH |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]](https://images.novusbio.com/images2/MMR_AF2535_Immunohistochemistry_15450.jpg)
![Western Blot MMR/CD206/Mannose Receptor Antibody [Unconjugated]](https://images.novusbio.com/images2/MMR_AF2535_Western_Blot_12738.jpg)
![Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]](https://images.novusbio.com/images2/MMR_AF2535_Immunohistochemistry_20447.jpg)
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")