![Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Western-Blot-NBP1-85740-img0021.jpg "Western Blot: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Analysis in human cell line U-87 MG.")
| Reactivity | Hu, Po, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK |
| Predicted Species | Mouse (90%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NT5E |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]](https://images.novusbio.com/images2/Endoglin_AF1320_Immunocytochemistry_7258.jpg)
![Immunocytochemistry Endoglin/CD105 Antibody [Unconjugated]](https://images.novusbio.com/images2/Endoglin_AF1320_Immunocytochemistry_12779.jpg)
![Simple Western Endoglin/CD105 Antibody [Unconjugated]](https://images.novusbio.com/images2/Endoglin_AF1320_Simple_Western_18976.jpg)
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-85740_7546.jpg)
Enlarge |
reviewed by:
Ewa Kaniewska |
WB | Human | 05/13/2014 |
Summary
|
||||||
Enlarge |
reviewed by:
Ewa Kaniewska |
IF | Human | 04/13/2014 |
Summary
|
||||||
-(01-ml)_NBP1-85740_6571.jpg)
Enlarge |
reviewed by:
Ewa Kaniewska |
ICC | Other | 03/27/2014 |
Summary
|
||||||
-(01-ml)_NBP1-85740_6566.jpg)
Enlarge |
reviewed by:
Ewa Kaniewska |
IHC-P | Human | 03/27/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for 5'-Nucleotidase/CD73 Antibody (NBP1-85740)Find related products by research area.
|
|
Adenosine Inhibits T cell Tumor Infiltration: KCa3.1, a New Anticancer Target By Yoskaly Lazo-Fernandez, PhD Role of Adenosine in the Tumor Microenvironment a Target for Cancer TherapyThe tumor microenvironment (TME) tends to be concentrated in the purine nucleoside adenosine, a direct resu... Read full blog post. |
|
CD73 (Cluster of differentiation 73, ecto-5'-nucleotidase) CD73 is a 70kD glycosyl-phosphatidylinositol (GPI)-anchored cell surface molecule that belongs to the 5'-nucleosidase family. It hydrolyzes extracellular nucleotides into membrane permeable nucleosides and is found as both a membrane-bound and soluble... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Ewa Kaniewska 05/13/2014 |
||
| Application: | WB | |
| Species: | Human |
| Ewa Kaniewska 04/13/2014 |
||
| Application: | IF | |
| Species: | Human |
| Ewa Kaniewska 03/27/2014 |
||
| Application: | ICC | |
| Species: | Other |
![Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for human aortic valve endothelial cells. Image from a verified customer review.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85740-img0024.jpg "Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for human aortic valve endothelial cells. Image from a verified customer review.")
![Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human liver shows strong membranous positivity in hepatocytes.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunohistochemistry-Paraffin-NBP1-85740-img0027.jpg "Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human liver shows strong membranous positivity in hepatocytes.")
![Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85740-img0023.jpg "Immunocytochemistry/Immunofluorescence: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human cell line LHCN-M2 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human aortic valve staining for CD73. Image from verified customer review.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunohistochemistry-NBP1-85740-img0019.jpg "Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human aortic valve staining for CD73. Image from verified customer review.")
![Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for pig aortic valve. Image from verified customer review.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunohistochemistry-NBP1-85740-img0020.jpg "Immunohistochemistry: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining for pig aortic valve. Image from verified customer review.")
![Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunohistochemistry-Paraffin-NBP1-85740-img0022.jpg "Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunohistochemistry-Paraffin-NBP1-85740-img0025.jpg "Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/5'-Nucleotidase-CD73-Antibody-Immunohistochemistry-Paraffin-NBP1-85740-img0026.jpg "Immunohistochemistry-Paraffin: 5'-Nucleotidase/CD73 Antibody [NBP1-85740] - Staining of human endometrium shows strong positivity in apical membrane in glandular cells.")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![NT-3 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "NT-3 [Unconjugated]")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-85740_7546.jpg)
-(01-ml)_NBP1-85740_6571.jpg)