Home » FAM58A » FAM58A Proteins » FAM58A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

FAM58A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FAM58A Protein (NBP2-14001PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FAM58A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM58A.

Source: E. coli

Amino Acid Sequence: GVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQIYTMDTE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCNQ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14001.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FAM58A Recombinant Protein Antigen

  • cyclin M
  • cyclin-M
  • cyclin-related protein FAM58A
  • family with sequence similarity 58, member A
  • MGC29729
  • STAR

Background

Mutations in this gene have been shown to cause an X-linked dominant STAR syndrome that typically manifests syndactyly,telecanthus and anogenital and renal malformations. The protein encoded by this gene contains a cyclin-box-fold domainwhich suggests it may have a role in controlling nuclear cell division cycles. Alternative splicing results inmultiple transcript variants encoding distinct isoforms. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CYP11A1 Antibody
NBP1-85368
Immunohistochemistry-Paraffin CYP11A1 Antibody
Immunohistochemistry-Paraffin CYP11A1 Antibody
Immunohistochemistry-Paraffin CYP11A1 Antibody
(4 Reviews)
(3 Publications)
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
SAM68 Antibody
NBP1-19151
Immunohistochemistry-Paraffin SAM68 Antibody
Western Blot SAM68 Antibody
(1 Review)
(2 Publications)
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
Aromatase Antibody
NB100-1596
Western Blot Aromatase Antibody
Western Blot Aromatase Antibody
Immunohistochemistry-Paraffin Aromatase Antibody
(16 Publications)
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
QKI/Quaking
Antibody
NBP1-87178
Immunohistochemistry QKI/Quaking Antibody
Immunohistochemistry-Paraffin QKI/Quaking Antibody
Immunohistochemistry-Paraffin QKI/Quaking Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB

SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Beta
Hydroxysteroid Dehydr ...
NBP1-32353
Immunohistochemistry-Paraffin Beta Hydroxysteroid Dehydrogenase Antibody
Western Blot Beta Hydroxysteroid Dehydrogenase Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HSD3B1 Antibody
(FDO66Q)
NB110-78644
Immunohistochemistry HSD3B1 Antibody (FDO66Q)
(12 Publications)
Species: Pm, Bv, Gt, Hu, Mu, Po, Pm, Rt, Sh
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Splicing Factor 1
Antibody (2E12)
H00007536-M01
Western Blot Splicing Factor 1 Antibody (2E12)
Western Blot Splicing Factor 1 Antibody (2E12)
Immunocytochemistry/ Immunofluorescence Splicing Factor 1 Antibody (2E12)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Immunohistochemistry Cytochrome P450 17A1 Antibody (OTI3F11)
Immunohistochemistry Cytochrome P450 17A1 Antibody (OTI3F11)
Flow Cytometry Cytochrome P450 17A1 Antibody (OTI3F11)
(2 Reviews)
(6 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(825 Publications)
Species: Hu
Applications: BA
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
KHDRBS3 Antibody
NBP1-84773
Immunohistochemistry-Paraffin KHDRBS3 Antibody
Immunohistochemistry-Paraffin KHDRBS3 Antibody
Immunohistochemistry-Paraffin KHDRBS3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
FAM58A Recombinant
Protein Antigen
NBP2-14001PEP
FAM58A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FAM58A Protein (NBP2-14001PEP) (0)

There are no publications for FAM58A Protein (NBP2-14001PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM58A Protein (NBP2-14001PEP) (0)

There are no reviews for FAM58A Protein (NBP2-14001PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FAM58A Protein (NBP2-14001PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM58A Products

Blogs on FAM58A

There are no specific blogs for FAM58A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FAM58A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CCNQ