Home » B-Raf » B-Raf Proteins » B-Raf Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

B-Raf Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for B-Raf Recombinant Protein Antigen (NBP2-59034PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

B-Raf Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRAF.

Source: E. coli

Amino Acid Sequence: PIPQEEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRAF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-59034.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for B-Raf Recombinant Protein Antigen

  • 94 kDa B-raf protein
  • B-Raf proto-oncogene serine/threonine-protein kinase (p94)
  • BRaf
  • B-Raf
  • BRAF1
  • B-RAF1
  • BRAF1MGC126806
  • EC 2.7.11.1
  • MGC138284
  • murine sarcoma viral (v-raf) oncogene homolog B1
  • NS7
  • p94
  • Proto-oncogene B-Raf
  • RAFB1
  • serine/threonine-protein kinase B-raf
  • v-raf murine sarcoma viral oncogene homolog B1FLJ95109

Background

B-Raf, also know as c-Rmil, is a Serine/Threonine protein kinase member of the Raf family which includes Raf-1 and A-Raf. B-Raf is involved in the transduction of mitogenic signals from the cell membrane to the nucleus (1). Composed of three conserved region (CR1, CR2, CR3) B-Raf is expressed primarily in the brain and in the nervous system (2). It has been observed that MAPK is activated by B-Raf in response to nerve growth factor (3). More than 60% of malignant melanomas were found to contain a specific mutation, B-Raf (V599E) the product of which possesses constitutive kinase activity (4). Mutations in B-Raf have also been identified in lung cancer and non-Hodgkin lymphoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

KRAS Antibody
(3B10-2F2)
H00003845-M01
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
Western Blot KRAS Antibody (3B10-2F2)
(1 Review)
(17 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Ret Antibody
[Unconjugated]
AF482
Immunohistochemistry Ret Antibody [Unconjugated]
Western Blot Ret Antibody [Unconjugated]
Immunohistochemistry Ret Antibody [Unconjugated]
(40 Publications)
Species: Mu
Applications: IHC, WB
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NRAS Antibody
(6S6F3)
NBP3-16473
Immunocytochemistry/ Immunofluorescence NRAS Antibody (6S6F3)
Western Blot NRAS Antibody (6S6F3)
Western Blot NRAS Antibody (6S6F3)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Patched 1/PTCH
Antibody (413220) [Un ...
MAB41051
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)
(10 Publications)
Species: Hu, Mu
Applications: IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ZHX2 Antibody
NBP1-82956
Immunocytochemistry/ Immunofluorescence ZHX2 Antibody
Immunohistochemistry-Paraffin ZHX2 Antibody
Immunohistochemistry-Paraffin ZHX2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HRAS Antibody
NBP2-42864
Western Blot HRAS Antibody
Western Blot HRAS Antibody
Western Blot HRAS Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Immunohistochemistry-Paraffin CCDC6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin Factor IX Antibody
Immunohistochemistry-Paraffin Factor IX Antibody
Immunocytochemistry/ Immunofluorescence Factor IX Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P
TAS2R38 Antibody
NBP2-33404
Immunohistochemistry TAS2R38 Antibody
Species: Hu
Applications: IHC, IHC-P
SNRPE Antibody
NBP2-43792
Western Blot SNRPE Antibody
Immunohistochemistry-Paraffin SNRPE Antibody
Immunohistochemistry-Paraffin SNRPE Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for B-Raf Recombinant Protein Antigen (NBP2-59034PEP) (0)

There are no publications for B-Raf Recombinant Protein Antigen (NBP2-59034PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for B-Raf Recombinant Protein Antigen (NBP2-59034PEP) (0)

There are no reviews for B-Raf Recombinant Protein Antigen (NBP2-59034PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for B-Raf Recombinant Protein Antigen (NBP2-59034PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional B-Raf Products

Research Areas for B-Raf Recombinant Protein Antigen (NBP2-59034PEP)

Find related products by research area.

Blogs on B-Raf.

Check out the latest blog posts on B-Raf.
Autophagy and RAS signaling: Clinical implications
By Christina Towers, PhD The cellular recycling process known as autophagy is currently being targeted in over 60 clinical trials focused on treating different types of cancer1. To date, the only autophagy-targeted ...  Read full blog post.
MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.
You can't be without me - SNF5
The protein encoded by SNF5 is a component of the chromatin-remodeling protein complex responsible for relieving repressive chromatin structures by allowing the transcriptional machinery to access targets more effectively. SNF5 has been found to be a ...  Read full blog post.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
EphB2 Antibody [Unconjugated]
AF467
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our B-Raf Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BRAF