Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATG9A. Source: E. coli Amino Acid Sequence: IYNICCYWEIHSFYLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | ATG9A |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32477. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here. |
Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for ATG9A Protein (NBP2-32477PEP)Find related products by research area.
|
Liver ASK1 activates autophagy to protect against hepatic fat accumulation, non-alcoholic steatohepatitis and fibrosis By Jamshed Arslan, Pharm. D., PhD. The most common chronic liver disorder worldwide is non-alcoholic fatty liver disease (NAFLD). This obesity-linked disorder can manifest as hepatic fat accumulation (steatosis) wit... Read full blog post. |
Mechanisms of Neurodegeneration: Protein aggregation and failure of autophagy By Michalina Hanzel, PhDIn a series of three blog posts I will briefly explore the major cellular mechanisms responsible for many neurodegenerative disorders. The first, and perhaps the most apparent, is the accumulat... Read full blog post. |
Animal Models to Study Autophagy By Christina Towers, PhD What is autophagy?Autophagy is the catabolic process that degrades cytoplasmic material via the lysosome. The process of macroautophagy was originally characterized in yeast, where the... Read full blog post. |
Atg9b - a marker for autophagosome induction and assembly Atg9 is the only essential transmembrane protein involved in cellular autophagy. Autophagy regulates cellular homeostasis by allowing the turnover and recycling of misfolded proteins and damaged organelles. Formation of the double-membrane isolatio... Read full blog post. |
ATG9A - early marker autophagosome assembly ATG9A is the only essential integral membrane protein involved in autophagy. ATG9A contains six transmembrane domains and initiates the assembly of autophagosomes. The autophagosome is a double-membrane structure that engulfs and eventually degrade... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ATG9A |