Home » Apolipoprotein H/ApoH » Apolipoprotein H/ApoH Proteins » Apolipoprotein H/ApoH Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Apolipoprotein H/ApoH Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Apolipoprotein H/ApoH Protein (NBP1-90046PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Apolipoprotein H/ApoH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOH.

Source: E. coli

Amino Acid Sequence: ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90046.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein H/ApoH Recombinant Protein Antigen

  • Activated protein C-binding protein
  • Anticardiolipin cofactor
  • APC inhibitor
  • APOH
  • apo-H
  • apolipoprotein H (beta-2-glycoprotein I)
  • Apolipoprotein H
  • B2G1
  • B2GP1
  • B2GPI
  • Beta
  • beta(2)GPI
  • beta-2-glycoprotein 1
  • Beta-2-glycoprotein I
  • BG

Background

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GNPDA1 Antibody
NBP2-24653
Western Blot GNPDA1 Antibody
Immunohistochemistry-Paraffin GNPDA1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MGMT Antibody (MT
23.2) - BSA Free
NB100-168
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
Flow Cytometry MGMT Antibody (MT 23.2) - BSA Free
Flow (Intracellular) MGMT Antibody (MT 23.2) - BSA Free
(21 Publications)
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Angiotensin II/III
Antibody (Ang II E7 ( ...
NB100-62346
Western Blot Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) - BSA Free
Immunohistochemistry Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) - BSA Free
Western Blot Angiotensin II/III Antibody (Ang II E7 (BGN/KA/4L)) - BSA Free
(19 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
AGXT Antibody
NBP1-89200
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
Immunohistochemistry-Paraffin AGXT Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB

beta-Glucuronidase/GUS
NBP1-87511
Immunocytochemistry/ Immunofluorescence beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Western Blot Coagulation Factor II/Thrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
EEF1A2 Antibody
NBP2-33280
Immunohistochemistry-Paraffin EEF1A2 Antibody
Immunohistochemistry-Paraffin EEF1A2 Antibody
Immunohistochemistry-Paraffin EEF1A2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(445 Publications)
Species: Hu
Applications: BA
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
PSMA1 Antibody
NBP1-81768
Immunocytochemistry/ Immunofluorescence PSMA1 Antibody
Western Blot PSMA1 Antibody
Immunohistochemistry-Paraffin PSMA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Apolipoprotein
H/ApoH Recombinant Pr ...
NBP1-90046PEP
Apolipoprotein H/ApoH Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Apolipoprotein H/ApoH Protein (NBP1-90046PEP) (0)

There are no publications for Apolipoprotein H/ApoH Protein (NBP1-90046PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein H/ApoH Protein (NBP1-90046PEP) (0)

There are no reviews for Apolipoprotein H/ApoH Protein (NBP1-90046PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein H/ApoH Protein (NBP1-90046PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein H/ApoH Products

Research Areas for Apolipoprotein H/ApoH Protein (NBP1-90046PEP)

Find related products by research area.

Blogs on Apolipoprotein H/ApoH

There are no specific blogs for Apolipoprotein H/ApoH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apolipoprotein H/ApoH Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol APOH