Home » UNC13B » UNC13B Proteins » UNC13B Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

UNC13B Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for UNC13B Protein (NBP1-83244PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

UNC13B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UNC13B.

Source: E. coli

Amino Acid Sequence: SQLSELDQYHEQDDDHRETDSIHSCHSSHSLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
UNC13B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83244.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for UNC13B Recombinant Protein Antigen

  • hmunc13
  • homolog of rat Munc13 (diacylglycerol-binding)
  • MGC133279
  • MGC133280
  • MUNC13
  • munc13-2
  • MUNC13B
  • protein unc-13 homolog B
  • unc-13 homolog B (C. elegans)
  • UNC13B
  • Unc13h2
  • unc-13-like (C. elegans)
  • UNC13Unc13h2

Background

The UNC13B gene is expressed in the kidney cortical epithelial cells and is upregulated by hyperglycemia. The encoded protein shares a high level of similarity to the rat homolog, and contains 3 C2 domains and a diacylglycerol-binding C1 domain. Hyperglycemia i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RIMS1 Antibody
NBP3-13395
Western Blot RIMS1 Antibody
Species: Mu, Rt
Applications: WB
UNC13D/Munc 13-4
Antibody
NB100-41385
Knockdown Validated UNC13D/Munc 13-4 Antibody
Knockdown Validated UNC13D/Munc 13-4 Antibody
Immunohistochemistry-Paraffin UNC13D/Munc 13-4 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, PEP-ELISA, WB
CtIP Antibody -
BSA Free
NBP1-77165
Immunohistochemistry CtIP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CtIP Antibody - BSA Free
Immunohistochemistry CtIP Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Doc2-alpha Antibody
AF7904
Western Blot Doc2-alpha Antibody
(1 Publication)
Species: Hu, Mu
Applications: WB
SNAP25 Antibody
(OTI4G5)
NBP2-00795
Flow Cytometry SNAP25 Antibody (OTI4G5)
Western Blot SNAP25 Antibody (OTI4G5)
Immunohistochemistry-Paraffin SNAP25 Antibody (OTI4G5)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Syntaxin-BP1
Antibody [Unconjugate
AF5675
Western Blot Syntaxin-BP1 Antibody [Unconjugated]
Immunohistochemistry Syntaxin-BP1 Antibody [Unconjugated]
Knockout Validated Syntaxin-BP1 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(23 Publications)
Species: Hu
Applications: IHC, KO, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Piccolo Antibody
NBP1-90250
Immunohistochemistry-Paraffin Piccolo Antibody
Immunohistochemistry-Paraffin Piccolo Antibody
Immunohistochemistry-Paraffin Piccolo Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DAB2 Antibody
AF8064
Western Blot DAB2 Antibody
Immunocytochemistry DAB2 Antibody
Immunohistochemistry DAB2 Antibody
(2 Publications)
Species: Hu
Applications: ICC, IHC, WB
UNC13B Recombinant
Protein Antigen
NBP1-83244PEP
UNC13B Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for UNC13B Protein (NBP1-83244PEP) (0)

There are no publications for UNC13B Protein (NBP1-83244PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UNC13B Protein (NBP1-83244PEP) (0)

There are no reviews for UNC13B Protein (NBP1-83244PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for UNC13B Protein (NBP1-83244PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UNC13B Products

Array NBP1-83244PEP

Research Areas for UNC13B Protein (NBP1-83244PEP)

Find related products by research area.

Blogs on UNC13B

There are no specific blogs for UNC13B, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Knockdown Validated: UNC13D/Munc 13-4 Antibody [NB100-41385] - A549 cells stably expressing control shRNA (Ctrl) or Munc13-4 shRNA were left untreated (Untr) or were treated with TGFbeta-1 for 24 h, and SDS-PAGE Western blotting for indicated proteins was conducted. Image collected and cropped by CiteAb from the following publication (jcb.org/lookup/doi/10.1083/jcb.201710132), licensed under a CC-BY license.
UNC13D/Munc 13-4 Antibody
NB100-41385

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our UNC13B Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol UNC13B