Novus Biologicals products are now on bio-techne.com

TROAP Recombinant Protein Antigen

Name: TROAP Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-92532PEP
Price: 279 USD

Images

There are currently no images for TROAP Protein (NBP1-92532PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

TROAP Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TROAP. Source: E. coli Amino Acid Sequence: EAPGTIEFVADPAALATILSGEGVKSCHLGRQPSLAKRVLVRGSQGGTTQRVQGVRASAYLAPRTPTHRLDPARASCFSRLEGPGPRGRTLCPQRLQALIS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	TROAP
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92532. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TROAP Recombinant Protein Antigen

TASTIN
trophinin assisting protein
trophinin associated protein (tastin)
trophinin-assisting protein (tastin)
Trophinin-assisting protein
Trophinin-associated protein

Background

Could be involved with bystin and trophinin in a cell adhesion molecule complex that mediates an initial attachment of the blastocyst to uterine epithelial cells at the time of the embryo implantation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BYSL Antibody

NBP1-89501

Immunohistochemistry-Paraffin BYSL Antibody

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

Trophinin Antibody
- BSA Free

NBP2-41320

Immunocytochemistry/ Immunofluorescence Trophinin Antibody - BSA Free

Western Blot Trophinin Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Trophinin Antibody
- BSA Free

NBP2-41320

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Eg5 Antibody

NB500-181

Immunocytochemistry/ Immunofluorescence Eg5 Antibody

(2 Reviews)

(21 Publications)

Species: Dr, Hu, Ma, Mu, Pl, Po, Rt

Applications: IB, ICC/IF, IP, WB

DYNLT1 Antibody
(SR2546)

NBP3-27809

Immunohistochemistry-Paraffin DYNLT1 Antibody (SR2546)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IP, WB

CHAF1A Antibody
(SS 1 1-13)

NB500-207

Immunocytochemistry/ Immunofluorescence CHAF1A Antibody (SS 1 1-13)

(11 Publications)

Species: Hu

Applications: ICC/IF, IP, WB

IKBKAP Antibody -
BSA Free

NBP1-76788

Species: Hu, Mu

Applications: ELISA, ICC/IF, WB

HMGB1/HMG-1
Antibody

NB100-2322

Immunohistochemistry-Paraffin HMGB1/HMG-1 Antibody

Immunocytochemistry/ Immunofluorescence HMGB1/HMG-1 Antibody

(5 Reviews)

(37 Publications)

Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh

Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB

c-Abl Antibody
[Unconjugated]

AF5414

Simple Western c-Abl Antibody [Unconjugated]

(1 Publication)

Species: Hu

Applications: Simple Western, WB

NuMA Antibody

NB500-174

(27 Publications)

Species: Hu, Ma, Mar, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

MCAT Antibody (2F2)

H00027349-M01

Species: Hu

Applications: ELISA, IHC, IHC-P, S-ELISA, WB

Aminopeptidase
N/CD13 Antibody [Unco ...

AF2335

Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]

(57 Publications)

Species: Mu

Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB

CTR9 Antibody

NB100-68205

Immunohistochemistry-Paraffin CTR9 Antibody

Species: Hu, Mu

Applications: IHC, IHC-P, IP, WB

iNOS Antibody -
BSA Free

NB300-605

(3 Reviews)

(130 Publications)

Species: Hu, Mu, Po, Rt

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

Clusterin/APOJ
Antibody [Unconjugate

AF2747

Western Blot Clusterin/APOJ Antibody [Unconjugated]

(13 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

PIK3R4 Antibody

NBP1-30463

(12 Publications)

Species: Hu, Mu, Rt, Ze

Applications: ICC/IF, IP, WB

Cytokeratin 8
Antibody

NBP2-16094

Immunohistochemistry-Paraffin Cytokeratin 8 Antibody

(1 Review)

(5 Publications)

Species: Hu, Mu, Ze

Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, KO, WB

TROAP Recombinant
Protein Antigen

NBP1-92532PEP

Species: Hu

Applications: AC

Publications for TROAP Protein (NBP1-92532PEP) (0)

There are no publications for TROAP Protein (NBP1-92532PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TROAP Protein (NBP1-92532PEP) (0)

There are no reviews for TROAP Protein (NBP1-92532PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TROAP Protein (NBP1-92532PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TROAP Products

Blogs on TROAP

There are no specific blogs for TROAP, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.

iNOS Antibody - BSA Free
NB300-605

HMGB1/HMG-1 Antibody
NB100-2322

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our TROAP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

TROAP

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

TROAP Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

TROAP Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for TROAP Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for TROAP Protein (NBP1-92532PEP) (0)

Reviews for TROAP Protein (NBP1-92532PEP) (0)

FAQs for TROAP Protein (NBP1-92532PEP) (0)

Additional TROAP Products

Blogs on TROAP

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics