Novus Biologicals products are now on bio-techne.com

TfR2 Recombinant Protein Antigen

Images

 
There are currently no images for TfR2 Recombinant Protein Antigen (NBP3-17003PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TfR2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TfR2

Source: E. coli

Amino Acid Sequence: SVLVVSEDVNYEPDLDFHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIRAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TFR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17003.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TfR2 Recombinant Protein Antigen

  • HFE3
  • HFE3transferrin receptor protein 2
  • MGC126368
  • TfR2
  • TFRC2
  • transferrin receptor 2

Background

TFR2 is a gene that codes for a protein with three isoforms, with lengths of 801, 630, and 774 amino acids and weights of approximately 89, 70, and 86 kDa respectively. TFR2 helps in the cellular uptake of transferrin-bound iron as well as iron metabolism, erythrocyte differentiation, and hepatocyte function. Current studies are being done on several diseases and disorders related to this gene including porphyria cutanea tarda, iron overload, beta thalassemia, liver cirrhosis, hepatitis C, fatty liver disease, leukemia, lymphoma, liver disease, and cystic fibrosis. TRF2 has also been shown to have interactions with HFE, TF, UBC, and SOCS3 in pathways such as the AMPK enzyme complex and iron metabolism in the placenta pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
DHP250
Species: Hu
Applications: ELISA
AF3720
Species: Hu, Mu
Applications: ICC, WB
2914-HT
Species: Hu
Applications: BA
NBP1-21502
Species: Bv, Hu, Mu, Po, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
507-BP
Species: Hu
Applications: BA
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00004891-M01
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP3-35158
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP3-35576
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-84071
Species: Hu
Applications: IHC, IHC-P, WB

Publications for TfR2 Recombinant Protein Antigen (NBP3-17003PEP) (0)

There are no publications for TfR2 Recombinant Protein Antigen (NBP3-17003PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TfR2 Recombinant Protein Antigen (NBP3-17003PEP) (0)

There are no reviews for TfR2 Recombinant Protein Antigen (NBP3-17003PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TfR2 Recombinant Protein Antigen (NBP3-17003PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TfR2 Products

Research Areas for TfR2 Recombinant Protein Antigen (NBP3-17003PEP)

Find related products by research area.

Blogs on TfR2

There are no specific blogs for TfR2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TfR2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TFR2