Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to SYP(synaptophysin) The peptide sequence was selected from the N terminal of SYP. Peptide sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE. The peptide sequence for this immunogen was taken from within the described region. |
Marker | Pre-synaptic marker |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SYP |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Synaptophysin Antibody (NBP1-59660)Find related products by research area.
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
Synaptophysin a Marker Protein in Neuroendocrine Cells Synaptophysin a Marker Protein in Neuroendocrine Cells Synaptophysin is a major integral membrane glycoprotein of neuronal synaptic vesicles present in virtually all synapses and shows a high degree of evolutionary conservation across the mammals. Syn... Read full blog post. |
Characterizing Synaptophysin is "a Snap" Synaptophysin is an integral membrane glycoprotein found within the small synaptic vesicles in brain and endocrine cells. Studies with synaptophysin antibodies show that it is one of the most abundant small vesicle proteins, constituting approximately... Read full blog post. |
Synaptophysin and Dementing Disorders Synaptophysin (a presynaptic vesicle protein) is an integral membrane glycoprotein originally isolated from presynaptic vesicles of bovine neurons. Synaptophysin is found in all nerve terminals and synaptophysin measurements have been used to quantif... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.