Home » Sulfatase Modifying Factor 2/SUMF2 » Sulfatase Modifying Factor 2/SUMF2 Proteins » Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUMF2.

Source: E. coli

Amino Acid Sequence: ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUMF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84145.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen

  • C-alpha-formyglycine-generating enzyme 2
  • C-alpha-formylglycine-generating enzyme 2
  • DKFZp566I1024
  • DKFZp686I1024
  • DKFZp686L17160
  • DKFZp781L1035
  • FGE2
  • MGC99485
  • paralog of the formylglycine-generating enzyme
  • pFGE
  • sulfatase modifying factor 2
  • sulfatase-modifying factor 2
  • SUMF2

Background

The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sulfatase
Modifying Factor 1/SU ...
AF3680
Western Blot Sulfatase Modifying Factor 1/SUMF1 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
Other Recombinant Human ARSH GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(148 Publications)
Species: Mu
Applications: ELISA
Arylsulfatase
A/ARSA Antibody
NBP1-00154
Immunohistochemistry-Paraffin Arylsulfatase A/ARSA Antibody
Immunohistochemistry-Paraffin Arylsulfatase A/ARSA Antibody
Western Blot Arylsulfatase A/ARSA Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
RERE Antibody (2F2)
H00000473-M06
Western Blot RERE Antibody (2F2)
ELISA RERE Antibody (2F2)
Immunocytochemistry/ Immunofluorescence RERE Antibody (2F2)
Species: Hu
Applications: ELISA, ICC/IF, WB
ZNF365 Antibody
(OTI1B7)
NBP2-03848
Western Blot ZNF365 Antibody (OTI1B7)
Immunohistochemistry-Paraffin ZNF365 Antibody (OTI1B7)
Immunohistochemistry-Paraffin ZNF365 Antibody (OTI1B7)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MANF Antibody
(1D10)
H00007873-M01
Western Blot MANF Antibody (1D10)
Immunocytochemistry/ Immunofluorescence MANF Antibody (1D10)
Sandwich ELISA MANF Antibody (1D10)
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Aldo-keto
Reductase 1B10/AKR1B1 ...
H00057016-M01
ELISA Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
Immunocytochemistry/ Immunofluorescence Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
Immunohistochemistry-Paraffin Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
(14 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
CRISP-1 Antibody
(840017) [Unconjugate ...
MAB4675
Western Blot CRISP-1 Antibody (840017) [Unconjugated]
Immunohistochemistry CRISP-1 Antibody (840017) [Unconjugated]
Neutralization CRISP-1 Antibody (840017) [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, Neut, WB
ARFRP1 Antibody
NBP2-14306
Western Blot ARFRP1 Antibody
Immunohistochemistry-Paraffin ARFRP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MKKS Antibody
NBP1-92123
Immunocytochemistry/ Immunofluorescence MKKS Antibody
Immunohistochemistry-Paraffin MKKS Antibody
Immunohistochemistry-Paraffin MKKS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Aldo-keto
Reductase 1C1/AKR1C1 ...
MAB6529
Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]
Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
ZNF148 Antibody -
BSA Free
NBP2-94521
Immunohistochemistry-Paraffin ZNF148 Antibody - BSA Free
Immunohistochemistry-Paraffin ZNF148 Antibody - BSA Free
Immunohistochemistry-Paraffin ZNF148 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Cadherin-13
Antibody [Unconjugate
AF3264
Immunohistochemistry Cadherin-13 Antibody [Unconjugated]
Immunocytochemistry Cadherin-13 Antibody [Unconjugated]
Simple Western Cadherin-13 Antibody [Unconjugated]
(19 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
TMC3 Antibody
NBP1-86240
Immunocytochemistry/ Immunofluorescence TMC3 Antibody
Immunohistochemistry-Paraffin TMC3 Antibody
Immunohistochemistry-Paraffin TMC3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ZNF537 Antibody -
BSA Free
NBP2-81880
Western Blot ZNF537 Antibody - BSA Free
Immunohistochemistry ZNF537 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ZNF537 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Fumarylacetoacetate hy
NBP2-48736
Immunohistochemistry-Paraffin Fumarylacetoacetate hydrolase Antibody
Immunohistochemistry-Paraffin Fumarylacetoacetate hydrolase Antibody
Western Blot Fumarylacetoacetate hydrolase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SAMM50 Antibody
NBP1-84509
Immunocytochemistry/ Immunofluorescence SAMM50 Antibody
Immunohistochemistry-Paraffin SAMM50 Antibody
Immunohistochemistry-Paraffin SAMM50 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP) (0)

There are no publications for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP) (0)

There are no reviews for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sulfatase Modifying Factor 2/SUMF2 Products

Blogs on Sulfatase Modifying Factor 2/SUMF2

There are no specific blogs for Sulfatase Modifying Factor 2/SUMF2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sulfatase Modifying Factor 2/SUMF2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SUMF2