![Western Blot: ST6 Sialyltransferase 6/ST6GALNAC6 Antibody [H00030815-B02P] - Analysis of ST6GALNAC6 expression in transfected 293T cell line by ST6GALNAC6 polyclonal antibody. Lane 1: ST6GALNAC6 transfected lysate(36.63 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ST6-Sialyltransferase-6-ST6GALNAC6-Antibody-Western-Blot-H00030815-B02P-img0002.jpg "Western Blot: ST6 Sialyltransferase 6/ST6GALNAC6 Antibody [H00030815-B02P] - Analysis of ST6GALNAC6 expression in transfected 293T cell line by ST6GALNAC6 polyclonal antibody. Lane 1: ST6GALNAC6 transfected lysate(36.63 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ST6GALNAC6 (NP_038471.2, 1 a.a. - 333 a.a.) full-length human protein. MACSRPPSQCEPTSLPPGPPAGRRHLPLSRRRREMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT |
| Specificity | ST6GALNAC6 - ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ST6GALNAC6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![ST6GALNAC4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ST6GALNAC4 [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ST6GALNAC6 |
| Entrez |
|
| Uniprot |
|
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![Simple Western ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST6GAL1_AF5924_Simple_Western_16761.jpg)
![Western Blot ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/ST6GAL1_AF5924_Western_Blot_9445.jpg)
![Immunocytochemistry ST6 Gal Sialyltransferase 1/ST6GAL1/CD75 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5924_human-st6gal1-affinity-purified-polyclonal-ab-immunocytochemistry-31102022135751.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")