![Western Blot: SRP72 Antibody [NBP1-89498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/SRP72-Antibody-Western-Blot-NBP1-89498-img0006.jpg "Western Blot: SRP72 Antibody [NBP1-89498] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ENALKTIESANQQTDKLKELYGQVLYRLERYDECLAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQEGTHELCYNTACA |
| Predicted Species | Mouse (98%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SRP72 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 06/22/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SRP72 |
![Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/SRP72-Antibody-Immunohistochemistry-Paraffin-NBP1-89498-img0010.jpg "Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human prostate shows moderate positivity in cytoplasm granular in glandular cells.](http://images.novusbio.com/fullsize/SRP72-Antibody-Immunohistochemistry-Paraffin-NBP1-89498-img0007.jpg "Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human prostate shows moderate positivity in cytoplasm granular in glandular cells.")
![Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/SRP72-Antibody-Immunohistochemistry-Paraffin-NBP1-89498-img0008.jpg "Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/SRP72-Antibody-Immunohistochemistry-Paraffin-NBP1-89498-img0009.jpg "Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/SRP72-Antibody-Immunohistochemistry-Paraffin-NBP1-89498-img0011.jpg "Immunohistochemistry-Paraffin: SRP72 Antibody [NBP1-89498] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Neutralization TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Block_Neutralize_875.jpg)
![Western Blot TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Western_Blot_5303.jpg)
![Immunohistochemistry TRAILR1/TNFRSF10A Antibody [Unconjugated]](https://images.novusbio.com/images2/TRAIL_R1_AF347_Immunohistochemistry_17355.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
