![Western Blot: SHARPIN Antibody [NBP1-92386] - Analysis in human cell lines PC-3 and Caco-2 using anti-SHARPIN antibody. Corresponding SHARPIN RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize/SHARPIN-Antibody-Western-Blot-NBP1-92386-img0008.jpg "Western Blot: SHARPIN Antibody [NBP1-92386] - Analysis in human cell lines PC-3 and Caco-2 using anti-SHARPIN antibody. Corresponding SHARPIN RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SHARPIN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: SHARPIN Antibody [NBP1-92386] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/SHARPIN-Antibody-Immunohistochemistry-Paraffin-NBP1-92386-img0006.jpg "Immunohistochemistry-Paraffin: SHARPIN Antibody [NBP1-92386] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Western Blot: SHARPIN Antibody [NBP1-92386] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/SHARPIN-Antibody-Western-Blot-NBP1-92386-img0005.jpg "Western Blot: SHARPIN Antibody [NBP1-92386] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
![Simple Western HOIP/RNF31 Antibody (875227) [Unconjugated]](https://images.novusbio.com/images2/HOIP_MAB8039_Simple_Western_17262.jpg)
![Western Blot HOIP/RNF31 Antibody (875227) [Unconjugated]](https://images.novusbio.com/images2/HOIP_MAB8039_Western_Blot_14890.jpg)
![Immunocytochemistry HOIP/RNF31 Antibody (875227) [Unconjugated]](https://images.novusbio.com/images2/HOIP_MAB8039_Immunocytochemistry_15168.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")