Home » SCYL1BP1 » SCYL1BP1 Proteins » SCYL1BP1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SCYL1BP1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SCYL1BP1 Protein (NBP1-92370PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SCYL1BP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GORAB.

Source: E. coli

Amino Acid Sequence: MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GORAB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92370.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SCYL1BP1 Recombinant Protein Antigen

  • FLJ11752
  • golgin, RAB6-interacting
  • GONTKL-binding protein 1
  • hNTKL-BP1
  • MGC51263
  • MGC70512
  • N-terminal kinase-like-binding protein 1
  • NTKL-BP1
  • NTKLBP1SCY1-like 1-binding protein 1
  • RAB6-interacting golgin
  • SCY1-like 1 binding protein 1
  • SCYL1-BP1
  • SCYL1BP1SCYL1-binding protein 1

Background

NTKL-binding protein 1 (GORAB) belongs to the golgin family of coiled-coil proteins located in the golgi apparatus. GORAB interacts with SCYL1, RCHY1 and RAB6A/RAB6. At least 4 isoforms are produced by alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Siglec-3/CD33
Antibody (44M12D3) - ...
NBP2-22377
Western Blot Siglec-3/CD33 Antibody (44M12D3) - BSA Free
Immunohistochemistry-Paraffin Siglec-3/CD33 Antibody (44M12D3) - BSA Free
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
TSHR Antibody
(484405) [Unconjugate
MAB6534
Western Blot TSHR Antibody (484405) [Unconjugated]
ELISA TSHR Antibody (484405) [Unconjugated]
Species: Hu
Applications: ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(815 Publications)
Species: Hu
Applications: BA
Pirh2 Antibody
NBP1-90098
Immunocytochemistry/ Immunofluorescence Pirh2 Antibody
Immunohistochemistry-Paraffin Pirh2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Nogo Antibody
NB100-56681
Immunocytochemistry/ Immunofluorescence Nogo Antibody
Simple Western Nogo Antibody
Immunohistochemistry-Paraffin Nogo Antibody
(23 Publications)
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
p120-catenin
Antibody (OTI2E8)
NBP2-45646
Immunohistochemistry p120-catenin Antibody (OTI2E8)
Immunohistochemistry p120-catenin Antibody (OTI2E8)
Immunohistochemistry p120-catenin Antibody (OTI2E8)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB

CSE1L/CAS/Exportin-2 A
H00001434-M08
Western Blot CSE1L/CAS/Exportin-2 Antibody (3D8)
Immunohistochemistry-Paraffin CSE1L/CAS/Exportin-2 Antibody (3D8)
Western Blot CSE1L/CAS/Exportin-2 Antibody (3D8)
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
p130Cas/BCAR1
Antibody (OTI1A9)
NBP2-00532
Flow Cytometry p130Cas/BCAR1 Antibody (OTI1A9)
Flow Cytometry p130Cas/BCAR1 Antibody (OTI1A9)
Flow Cytometry p130Cas/BCAR1 Antibody (OTI1A9)
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
N/A Coagulation Factor III/Tissue Factor [HRP]
N/A Coagulation Factor III/Tissue Factor [HRP]
(26 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

IL-1ra/IL-1F3/IL1RN [H
DRA00B
N/A IL-1ra/IL-1F3/IL1RN [HRP]
N/A IL-1ra/IL-1F3/IL1RN [HRP]
N/A IL-1ra/IL-1F3/IL1RN [HRP]
(100 Publications)
Species: Hu
Applications: ELISA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(51 Publications)
Species: Hu
Applications: BA
Glutamine
Synthetase Antibody
NB110-41404
Immunocytochemistry/ Immunofluorescence Glutamine Synthetase Antibody
Western Blot Glutamine Synthetase Antibody
Immunohistochemistry Glutamine Synthetase Antibody
(1 Review)
(11 Publications)
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB

Publications for SCYL1BP1 Protein (NBP1-92370PEP) (0)

There are no publications for SCYL1BP1 Protein (NBP1-92370PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SCYL1BP1 Protein (NBP1-92370PEP) (0)

There are no reviews for SCYL1BP1 Protein (NBP1-92370PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SCYL1BP1 Protein (NBP1-92370PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SCYL1BP1 Products

Blogs on SCYL1BP1

There are no specific blogs for SCYL1BP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SCYL1BP1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GORAB