Home » SALL4 » SALL4 Peptides and Proteins » Recombinant Human SALL4 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human SALL4 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
Recombinant Human SALL4 Protein [H00057167-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human SALL4 Protein [H00057167-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SALL4 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 954-1053 of Human SALL4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SALL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SALL4 GST (N-Term) Protein

  • dJ1112F19.1
  • DRRS
  • HSAL4
  • MGC133050
  • SALL4
  • sal-like 4 (Drosophila)
  • sal-like protein 4
  • Zinc finger protein 797
  • Zinc finger protein SALL4
  • ZNF797
  • ZNF797sal (Drosophila)-like 4

Background

SALL4 - sal-like 4 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NANOGP8 Antibody
H00388112-B01P
Western Blot NANOGP8 Antibody
Species: Hu
Applications: WB
Nanog Antibody
[Unconjugated]
AF1997
Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
Immunocytochemistry Nanog Antibody [Unconjugated]
(5 Reviews)
(309 Publications)
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
SALL1 Antibody
(K9814) [Unconjugated
PP-K9814-00
Immunocytochemistry/ Immunofluorescence SALL1 Antibody (K9814) [Unconjugated]
(12 Publications)
Species: Hu
Applications: IHC, IP, WB
Glypican 3
Antibody [Unconjugate
AF2119
Immunocytochemistry Glypican 3 Antibody [Unconjugated]
Immunohistochemistry Glypican 3 Antibody [Unconjugated]
Western Blot Glypican 3 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, IHC, WB
TBX5 Antibody
NBP1-83237
Immunohistochemistry-Paraffin TBX5 Antibody
Immunohistochemistry-Paraffin TBX5 Antibody
Immunohistochemistry-Paraffin TBX5 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
KLF4 Antibody
[Unconjugated]
AF3158
Chromatin Immunoprecipitation (ChIP) KLF4 Antibody [Unconjugated]
Immunocytochemistry KLF4 Antibody [Unconjugated]
Immunohistochemistry KLF4 Antibody [Unconjugated]
(2 Reviews)
(88 Publications)
Species: Mu
Applications: ChIP, ICC, IHC, WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(90 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
LIN-28A Antibody
[Unconjugated]
AF3757
Immunocytochemistry LIN-28A Antibody [Unconjugated]
Immunocytochemistry LIN-28A Antibody [Unconjugated]
Western Blot LIN-28A Antibody [Unconjugated]
(1 Review)
(22 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
TRIM26 Antibody
NBP2-47594
Immunocytochemistry/ Immunofluorescence TRIM26 Antibody
Immunohistochemistry-Paraffin TRIM26 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CDX2 Antibody
NBP2-24583
Western Blot CDX2 Antibody
Western Blot CDX2 Antibody
Immunohistochemistry-Paraffin CDX2 Antibody
Species: Bv, Eq, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Steroid sulfatase
Antibody
NBP1-90095
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
Immunohistochemistry-Paraffin Steroid sulfatase Antibody
(3 Publications)
Species: Hu
Applications: IHC, IHC-P
TCL1A Antibody
(1-21) - BSA Free
NBP1-43253
Flow Cytometry TCL1A Antibody (1-21) - BSA Free
Immunohistochemistry-Paraffin TCL1A Antibody (1-21) - BSA Free
(1 Review)
Species: Hu
Applications: Flow, IHC, IHC-P, IP, WB
Recombinant Human
SALL4 GST (N-Term) Pr ...
H00057167-Q01
Recombinant Human SALL4 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for SALL4 Partial Recombinant Protein (H00057167-Q01) (0)

There are no publications for SALL4 Partial Recombinant Protein (H00057167-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SALL4 Partial Recombinant Protein (H00057167-Q01) (0)

There are no reviews for SALL4 Partial Recombinant Protein (H00057167-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SALL4 Partial Recombinant Protein (H00057167-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SALL4 Products

Blogs on SALL4

There are no specific blogs for SALL4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018
BG01V human embryonic stem cells were fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. Nanog/DNA complexes were immunoprecipitated using 5 μg Goat Anti-Human Nanog Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1997) or control antibody (Catalog # AB-108-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Goat IgG Secondary Antibody (Catalog # BAF109). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The nanog promoter was detected by standard PCR.
Nanog Antibody [Unconjugated]
AF1997

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SALL4 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SALL4