![Western Blot: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Western blot analysis of extracts of various cell lines, using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Western-Blot-NBP3-16435-img0006.jpg "Western Blot: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Western blot analysis of extracts of various cell lines, using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clone | 2I6C5 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human RNA Helicase A (Q08211). ITGLRAAMEALVVEVTKQPAIISQLDPVNERMLNMIRQISRPSAAGINLMIGSTRYGDGPRPPKMARYDNGSGYRRGGSSYSGGGYGGGYSSGGYGSGGYG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | DHX9 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RNA Helicase A Antibody (NBP3-16435)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DHX9 |
![Immunocytochemistry/Immunofluorescence: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunofluorescence analysis of U-2 OS cells using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Immunocytochemistry-Immunofluorescence-NBP3-16435-img0005.jpg "Immunocytochemistry/Immunofluorescence: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunofluorescence analysis of U-2 OS cells using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry of paraffin-embedded mouse spinal cord using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Immunohistochemistry-Paraffin-NBP3-16435-img0003.jpg "Immunohistochemistry-Paraffin: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry of paraffin-embedded mouse spinal cord using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunofluorescence analysis of NIH-3T3 cells using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Immunocytochemistry-Immunofluorescence-NBP3-16435-img0004.jpg "Immunocytochemistry/Immunofluorescence: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunofluorescence analysis of NIH-3T3 cells using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry of paraffin-embedded rat brain using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Immunohistochemistry-Paraffin-NBP3-16435-img0001.jpg "Immunohistochemistry-Paraffin: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry of paraffin-embedded rat brain using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry of paraffin-embedded human placenta using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Immunohistochemistry-Paraffin-NBP3-16435-img0002.jpg "Immunohistochemistry-Paraffin: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunohistochemistry of paraffin-embedded human placenta using DHX9/RNA Helicase A Rabbit mAb (NBP3-16435) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug DHX9/RNA Helicase A antibody (NBP3-16435). Western blot was performed from the immunoprecipitate using DHX9/RNA Helicase A antibody (NBP3-16435) at a dilition of 1:2000.](http://images.novusbio.com/fullsize/RNA-Helicase-A-Antibody-2I6C5-Immunoprecipitation-NBP3-16435-img0007.jpg "Immunoprecipitation: RNA Helicase A Antibody (2I6C5) [NBP3-16435] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug DHX9/RNA Helicase A antibody (NBP3-16435). Western blot was performed from the immunoprecipitate using DHX9/RNA Helicase A antibody (NBP3-16435) at a dilition of 1:2000.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Immunocytochemistry LIN-28A Antibody [Unconjugated]](https://images.novusbio.com/images2/LIN-28A_AF3757_Immunocytochemistry_6502.jpg)
![Immunocytochemistry LIN-28A Antibody [Unconjugated]](https://images.novusbio.com/images2/LIN-28A_AF3757_Immunocytochemistry_12362.jpg)
![Western Blot LIN-28A Antibody [Unconjugated]](https://images.novusbio.com/images2/LIN-28A_AF3757_Western_Blot_9318.jpg)
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")