Novus Biologicals products are now on bio-techne.com

RIPK1/RIP1 Recombinant Protein Antigen

Images

 
There are currently no images for RIPK1/RIP1 Protein (NBP1-87128PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

RIPK1/RIP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIPK1.

Source: E. coli

Amino Acid Sequence: KEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RIPK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87128.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RIPK1/RIP1 Recombinant Protein Antigen

  • Cell death protein RIP
  • EC 2.7.11.1
  • receptor (TNFRSF)-interacting serine-threonine kinase 1
  • receptor interacting protein
  • Receptor-interacting protein 1
  • receptor-interacting serine/threonine-protein kinase 1
  • RIP
  • Rip1 kinase
  • RIP1
  • RIP-1
  • RIPFLJ39204
  • RIPK1
  • Serine/threonine-protein kinase RIP

Background

RIP (Receptor Interacting Protein) is a 74 kD Ser/Thr kinase which interacts with CD95 (Fas/APO1) receptor and the tumor necrosis factor receptor (TNFR1). It is a cell death domain adapter protein which can bind to the adapter proteins TRADD, RAID (CRADD) and TRAF2. RIP contains an N terminal region with homology to protein kinases, an intermediate domain capable of association with MAPKKK and a C terminal region containing an intracellular death domain motif. RIP activates both p38 MAP Kinase and SAPK families. In vitro, RIP induces apoptosis, as well as SAPK/JNK and NF-kB activation. NF-kB activation through TRADD, TRAF2 and RIP can be triggered also by DR3/APO3 upon activation with APO3/Tweak ligand. DR4 and DR5 also use FADD, TRADD, and RIP in their signal transduction pathways. RIP deficient mice fail to thrive, displaying extensive apoptosis in both lymphoid and adipose tissues and dying at 1-3 days of age. RIP possesses kinase activity as it autophosphorylates itself on serine and threonine residues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MAB7047
Species: Hu
Applications: ICC, WB
NBP1-77299
Species: Hu, Mu, Rt
Applications: ELISA, GS, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
DRT100
Species: Hu
Applications: ELISA
AF2658
Species: Hu
Applications: ICC, IHC, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
375-TL
Species: Hu
Applications: BA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF821
Species: Hu, Mu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-91991
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-87128PEP
Species: Hu
Applications: AC

Publications for RIPK1/RIP1 Protein (NBP1-87128PEP) (0)

There are no publications for RIPK1/RIP1 Protein (NBP1-87128PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIPK1/RIP1 Protein (NBP1-87128PEP) (0)

There are no reviews for RIPK1/RIP1 Protein (NBP1-87128PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RIPK1/RIP1 Protein (NBP1-87128PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIPK1/RIP1 Products

Research Areas for RIPK1/RIP1 Protein (NBP1-87128PEP)

Find related products by research area.

Blogs on RIPK1/RIP1

There are no specific blogs for RIPK1/RIP1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RIPK1/RIP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RIPK1