![Western Blot: RAB3B Antibody (3F12) [H00005865-M01] - Analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M01), clone 3F12.Lane 1: RAB3B transfected lysate(24.758 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/RAB3B-Antibody-3F12-Western-Blot-H00005865-M01-img0012.jpg "Western Blot: RAB3B Antibody (3F12) [H00005865-M01] - Analysis of RAB3B expression in transfected 293T cell line by RAB3B monoclonal antibody (M01), clone 3F12.Lane 1: RAB3B transfected lysate(24.758 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 3F12 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | RAB3B (AAH05035, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC |
| Specificity | RAB3B - RAB3B, member RAS oncogene family |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RAB3B |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recominant protein, transfected lysate and cell lysate for WB. It has been used for IF, IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
| Publications using H00005865-M01 | Applications | Species |
|---|---|---|
| Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01 | ||
| Roberto C, Valeria R, Cristina N et al. Gut-derived endotoxin stimulates factor viii secretion from endothelial cells. implications for hypercoagulability in cirrhosis. J Hepatol 2017-07-14 [PMID: 28716745] | ||
| Vogel GF, Klee KM, Janecke AR et al. Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3. J Cell Biol. 2015-11-09 [PMID: 26553929] |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB3B Antibody (H00005865-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: RAB3B Antibody (3F12) [H00005865-M01] - Analysis of monoclonal antibody to RAB3B on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/RAB3B-Antibody-3F12-Immunocytochemistry-Immunofluorescence-H00005865-M01-img0007.jpg "Immunocytochemistry/Immunofluorescence: RAB3B Antibody (3F12) [H00005865-M01] - Analysis of monoclonal antibody to RAB3B on HeLa cell. Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: RAB3B Antibody (3F12) [H00005865-M01] - Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]](http://images.novusbio.com/fullsize/RAB3B-Antibody-3F12-Immunohistochemistry-Paraffin-H00005865-M01-img0014.jpg "Immunohistochemistry-Paraffin: RAB3B Antibody (3F12) [H00005865-M01] - Immunoperoxidase of monoclonal antibody to RAB3B on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]")
![Western Blot: RAB3B Antibody (3F12) [H00005865-M01] - RAB3B monoclonal antibody (M01), clone 3F12. Analysis of RAB3B expression in IMR-32.](http://images.novusbio.com/fullsize/RAB3B-Antibody-3F12-Western-Blot-H00005865-M01-img0011.jpg "Western Blot: RAB3B Antibody (3F12) [H00005865-M01] - RAB3B monoclonal antibody (M01), clone 3F12. Analysis of RAB3B expression in IMR-32.")
![ELISA: RAB3B Antibody (3F12) [H00005865-M01] - Detection limit for recombinant GST tagged RAB3B is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RAB3B-Antibody-3F12-ELISA-H00005865-M01-img0013.jpg "ELISA: RAB3B Antibody (3F12) [H00005865-M01] - Detection limit for recombinant GST tagged RAB3B is approximately 0.1ng/ml as a capture antibody.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Western Blot Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neurogenin-3_AF3444_Western_Blot_5300.jpg)
![Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3444_human-neurogenin-3-affinity-purified-polyclonal-ab-immunohistochemistry-192021141921.jpg)
