PRPS1L1 Antibody (5E10) Summary
Immunogen |
PRPS1L1 (NP_787082, 146 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YAEPTVLKWIRENIPEWKNCIIVSPDAGGAKRVTSIADQLNVDFALIHKERKKANEVDCIVLVGDVNDRVAILVDDMADTCVTICLAADKLLSAGATR |
Localization |
Cytoplasmic |
Specificity |
PRPS1L1 - phosphoribosyl pyrophosphate synthetase 1-like 1 |
Isotype |
IgG3 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PRPS1L1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PRPS1L1 Antibody (5E10)
Background
This intronless gene is specifically expressed in the testis, and encodes a protein that is highly homologous to the two subunits of phosphoribosylpyrophosphate synthetase encoded by human X-linked genes, PRPS1 and PRPS2. These enzymes convert pyrimidine, purine or pyridine bases to the corresponding ribonucleoside monophosphates. In vitro transcription/translation and site-directed mutagenesis studies indicate that translation of this mRNA initiates exclusively at a non-AUG (ACG) codon.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IP, KO, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ELISA, AP, PA, WB
Publications for PRPS1L1 Antibody (H00221823-M01) (0)
There are no publications for PRPS1L1 Antibody (H00221823-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PRPS1L1 Antibody (H00221823-M01) (0)
There are no reviews for PRPS1L1 Antibody (H00221823-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PRPS1L1 Antibody (H00221823-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PRPS1L1 Products
Research Areas for PRPS1L1 Antibody (H00221823-M01)
Find related products by research area.
|
Blogs on PRPS1L1