Reactivity | HuSpecies Glossary |
Applications | ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAH |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PPOX |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publications using NBP1-80885 | Applications | Species |
---|---|---|
vorgelegt v, Wen W Expression and function of blood receptors ROR?, REVERBA and BMAL1 in human colorectal cancer Thesis 2022-01-01 | ||
Weimar, HV, HV Investigating the Impacts of Maternal Cannabis Use on Developing Offspring in Rats Thesis 2022-01-01 |
Secondary Antibodies |
Isotype Controls |
Research Areas for PPOX Antibody (NBP1-80885)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.