Novus Biologicals products are now on bio-techne.com

POMC Recombinant Protein Antigen

Images

 
There are currently no images for POMC Recombinant Protein Antigen (NBP2-57719PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

POMC Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POMC.

Source: E. coli

Amino Acid Sequence: SQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POMC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57719.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POMC Recombinant Protein Antigen

  • ACTH
  • adrenocorticotropic hormone
  • adrenocorticotropin
  • alpha-melanocyte-stimulating hormone
  • alpha-MSH
  • beta-endorphin
  • beta-LPH
  • beta-melanocyte-stimulating hormone
  • beta-MSH
  • CLIP
  • corticotropin-like intermediary peptide
  • corticotropin-lipotropin
  • gamma-LPH
  • gamma-MSH
  • lipotropin beta
  • lipotropin gamma
  • LPH
  • melanotropin alpha
  • melanotropin beta
  • melanotropin gamma
  • met-enkephalin
  • MSH
  • NPP
  • POC
  • POMC
  • pro-ACTH-endorphin
  • proopiomelanocortin preproprotein
  • proopiomelanocortin
  • pro-opiomelanocortin

Background

POMC encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
AF009
Species: Hu
Applications: IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
7570-GH
Species: Hu
Applications: EnzAct
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
9134-TN
Species: Hu
Applications: BA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
MAB4447
Species: Hu
Applications: IHC, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-57719PEP
Species: Hu
Applications: AC

Publications for POMC Recombinant Protein Antigen (NBP2-57719PEP) (0)

There are no publications for POMC Recombinant Protein Antigen (NBP2-57719PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMC Recombinant Protein Antigen (NBP2-57719PEP) (0)

There are no reviews for POMC Recombinant Protein Antigen (NBP2-57719PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POMC Recombinant Protein Antigen (NBP2-57719PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POMC Products

Research Areas for POMC Recombinant Protein Antigen (NBP2-57719PEP)

Find related products by research area.

Blogs on POMC

There are no specific blogs for POMC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POMC Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POMC