Novus Biologicals products are now on bio-techne.com

POLD3 Recombinant Protein Antigen

Name: POLD3 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-38862PEP
Price: 289 USD

Images

There are currently no images for POLD3 Protein (NBP2-38862PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

POLD3 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POLD3. Source: E. coli Amino Acid Sequence: SVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	POLD3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38862. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POLD3 Recombinant Protein Antigen

DNA polymerase delta subunit 3
DNA polymerase delta subunit p66
DNA polymerase delta, subunit 3
KIAA0039MGC119643
MGC119642
P66
P68
polymerase (DNA directed), delta 3
polymerase (DNA-directed), delta 3, accessory subunit

Background

PolD3/p66 is a subunit of the heterotetrameric DNA polymerase delta that plays a role in DNA replication and repair. The PolD3/p66 subunit has been shown to mediate the interaction between DNA polymerase delta and PCNA (proliferating cell nuclear antigen) to facilitate processivity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHC1 Antibody
(OTI3A1)

NBP2-02434

Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

p63/TP73L Antibody
[Unconjugated]

AF1916

Immunocytochemistry p63/TP73L Antibody [Unconjugated]

Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]

(1 Review)

(24 Publications)

Species: Hu

Applications: ICC, IHC, WB

ZNF398 Antibody -
BSA Free

NBP1-31317

Immunocytochemistry/ Immunofluorescence ZNF398 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

POMT1 Antibody

NBP3-12487

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, WB

PCNA Antibody
(PC10) - BSA Free

NB500-106

Western Blot PCNA Antibody (PC10) - BSA Free

Flow Cytometry PCNA Antibody (PC10) - BSA Free

(5 Reviews)

(48 Publications)

Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze

Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

DDX17 Antibody
(2U1P0)

NBP3-16607

Immunohistochemistry DDX17 Antibody (2U1P0)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, Simple Western, WB

DDX5 Antibody

NB200-351

(1 Review)

(5 Publications)

Species: Ha, Hu, Mu

Applications: IHC, IHC-P, IP, WB

LEDGF Antibody
(762815) [Unconjugate

MAB3468

Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]

(1 Review)

(1 Publication)

Species: Hu

Applications: ICC, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(43 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

TNF RI/TNFRSF1A
[HRP]

DRT100

(86 Publications)

Species: Hu

Applications: ELISA

ARHGEF7 Antibody -
BSA Free

NBP1-88650

Immunohistochemistry-Paraffin ARHGEF7 Antibody - BSA Free

Species: Hu

Applications: IHC, IHC-P, KD, WB

Annexin A6
Antibody - BSA Free

NBP1-90149

Immunohistochemistry-Paraffin Annexin A6 Antibody - BSA Free

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

NFkB2/NFkB p100
Antibody - BSA Free

NBP1-87760

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

FKBP52/FKBP4
Antibody (5C11) - Azi ...

H00002288-M01

Western Blot FKBP52/FKBP4 Antibody (5C11) - Azide and BSA Free

Immunohistochemistry-Paraffin FKBP52/FKBP4 Antibody (5C11) - Azide and BSA Free

(2 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, IP, WB

TPPP/p25 Antibody
- BSA Free

NBP2-34031

Immunohistochemistry-Paraffin TPPP/p25 Antibody - BSA Free

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

GTF2H4 Antibody -
Azide and BSA Free

H00002968-B01P

Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody - Azide and BSA Free

Species: Hu

Applications: ICC/IF, WB

Calcium-binding-protei ...

NBP1-33736

Immunocytochemistry/ Immunofluorescence Calcium-binding-protein-P22 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

POLD3 Recombinant
Protein Antigen

NBP2-38862PEP

Species: Hu

Applications: AC

Publications for POLD3 Protein (NBP2-38862PEP) (0)

There are no publications for POLD3 Protein (NBP2-38862PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLD3 Protein (NBP2-38862PEP) (0)

There are no reviews for POLD3 Protein (NBP2-38862PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POLD3 Protein (NBP2-38862PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLD3 Products

Research Areas for POLD3 Protein (NBP2-38862PEP)

Find related products by research area.

Cell Cycle and Replication

Blogs on POLD3

There are no specific blogs for POLD3, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.

PCNA Antibody (PC10) - BSA Free
NB500-106

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our POLD3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

POLD3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

POLD3 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

POLD3 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for POLD3 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for POLD3 Protein (NBP2-38862PEP) (0)

Reviews for POLD3 Protein (NBP2-38862PEP) (0)

FAQs for POLD3 Protein (NBP2-38862PEP) (0)

Additional POLD3 Products

Research Areas for POLD3 Protein (NBP2-38862PEP)

Blogs on POLD3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics