![Western Blot: PER2 Antibody [NBP2-93587] - Analysis of extracts of 293T cells, using PER2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/PER2-Antibody-Western-Blot-NBP2-93587-img0002.jpg "Western Blot: PER2 Antibody [NBP2-93587] - Analysis of extracts of 293T cells, using PER2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, Rt, AmSpecies Glossary |
| Applications | WB, ELISA, IHC, ChIP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 390-565 of human PER2 (NP_073728.1). GQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PER2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
IHC-Fr | Other | 09/11/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for PER2 Antibody (NBP2-93587)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PER2 |
![Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Mouse testis using PER2 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/PER2-Antibody-Immunohistochemistry-Paraffin-NBP2-93587-img0005.jpg "Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Mouse testis using PER2 Rabbit pAb at dilution of 1:100 (40x lens).")
![Chromatin Immunoprecipitation: PER2 Antibody [NBP2-93587] - Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (NBP2-93587) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/PER2-Antibody-Chromatin-Immunoprecipitation-NBP2-93587-img0006.jpg "Chromatin Immunoprecipitation: PER2 Antibody [NBP2-93587] - Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using PER2 antibody (NBP2-93587) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Western Blot: PER2 Antibody [NBP2-93587] - Analysis of extracts of Mouse liver, using PER2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/PER2-Antibody-Western-Blot-NBP2-93587-img0001.jpg "Western Blot: PER2 Antibody [NBP2-93587] - Analysis of extracts of Mouse liver, using PER2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.")
![Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Rat spleen using PER2 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/PER2-Antibody-Immunohistochemistry-Paraffin-NBP2-93587-img0003.jpg "Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Rat spleen using PER2 Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Human thyroid cancer using PER2 Rabbit pAb at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/PER2-Antibody-Immunohistochemistry-Paraffin-NBP2-93587-img0004.jpg "Immunohistochemistry-Paraffin: PER2 Antibody [NBP2-93587] - Human thyroid cancer using PER2 Rabbit pAb at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Frozen: Rabbit Polyclonal PER2 Antibody [NBP2-93587] - 10X magnification. Immunoreactive cell bodies (DAB staining) along the 4th ventricle in 20um from Hyla cinerea. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp2-93587_rabbit-polyclonal-per2-antibody-immunohistochemistry-frozen-510202311487..png "Immunohistochemistry-Frozen: Rabbit Polyclonal PER2 Antibody [NBP2-93587] - 10X magnification. Immunoreactive cell bodies (DAB staining) along the 4th ventricle in 20um from Hyla cinerea. Image from a verified customer review.")
![Immunocytochemistry CRY1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CRY1_AF3764_Immunocytochemistry__Immunofluorescence_19530.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
