Novus Biologicals products are now on bio-techne.com

ORC1 Recombinant Protein Antigen

Images

 
There are currently no images for ORC1 Protein (NBP1-83184PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ORC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ORC1.

Source: E. coli

Amino Acid Sequence: YISGVPGTGKTATVHEVIRCLQQAAQANDVPPFQYIEVNGMKLTEPHQVYVQILQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ORC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83184.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ORC1 Recombinant Protein Antigen

  • HS
  • HSORC1
  • ORC1Lorigin recognition complex subunit 1
  • origin recognition complex, subunit 1 (yeast homolog)-like
  • origin recognition complex, subunit 1 homolog (S. cerevisiae)
  • origin recognition complex, subunit 1 homolog
  • origin recognition complex, subunit 1
  • origin recognition complex, subunit 1-like (yeast)
  • origin recognition complex, subunit 1-like
  • PARC1origin recognition complex 1
  • Replication control protein 1

Background

The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is the largest subunit of the ORC complex. While other ORC subunits are stable throughout the cell cycle, the levels of this protein vary during the cell cycle, which has been shown to be controlled by ubiquitin-mediated proteolysis after initiation of DNA replication. This protein is found to be selectively phosphorylated during mitosis. It is also reported to interact with MYST histone acetyltransferase 2 (MyST2/HBO1), a protein involved in control of transcription silencing. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09473
Species: Hu
Applications: WB
H00004999-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-798
Species: Hu, Mu
Applications: PEP-ELISA, WB
H00023594-M04
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NBP1-82476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NB100-2567
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-796
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC, IHC-P, IP, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP3-15386
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB100-79778
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83184PEP
Species: Hu
Applications: AC

Publications for ORC1 Protein (NBP1-83184PEP) (0)

There are no publications for ORC1 Protein (NBP1-83184PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ORC1 Protein (NBP1-83184PEP) (0)

There are no reviews for ORC1 Protein (NBP1-83184PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ORC1 Protein (NBP1-83184PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ORC1 Products

Research Areas for ORC1 Protein (NBP1-83184PEP)

Find related products by research area.

Blogs on ORC1

There are no specific blogs for ORC1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ORC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ORC1