![Western Blot: OCRL Antibody (4A6) [H00004952-M02] - Analysis of OCRL expression in transfected 293T cell line by OCRL monoclonal antibody (M02), clone 4A6.Lane 1: OCRL transfected lysate(103.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/OCRL-Antibody-4A6-Western-Blot-H00004952-M02-img0011.jpg "Western Blot: OCRL Antibody (4A6) [H00004952-M02] - Analysis of OCRL expression in transfected 293T cell line by OCRL monoclonal antibody (M02), clone 4A6.Lane 1: OCRL transfected lysate(103.2 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC, KD |
| Clone | 4A6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | OCRL (NP_000267, 146 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT |
| Specificity | OCRL - oculocerebrorenal syndrome of Lowe |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | OCRL |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Western_Blot_6027.jpg)
![Immunocytochemistry SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images2/SHIP_MAB2317_Immunocytochemistry_9852.jpg)
![Knockout Validated SHIP Antibody (257812) [Unconjugated]](https://images.novusbio.com/images/mab2317_human-mouse-rat-ship-mab-clone-257812-20820241518568.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for OCRL Antibody (H00004952-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: OCRL Antibody (4A6) [H00004952-M02] - Analysis of monoclonal antibody to OCRL on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/OCRL-Antibody-4A6-Immunohistochemistry-Paraffin-H00004952-M02-img0007.jpg "Immunohistochemistry-Paraffin: OCRL Antibody (4A6) [H00004952-M02] - Analysis of monoclonal antibody to OCRL on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.")
![Western Blot: OCRL Antibody (4A6) [H00004952-M02] - Analysis of OCRL over-expressed 293 cell line, cotransfected with OCRL Validated Chimera RNAi ( Cat # H00004952-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with OCRL monoclonal antibody (M02), clone 4A6 (Cat # H00004952-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/OCRL-Antibody-4A6-Western-Blot-H00004952-M02-img0008.jpg "Western Blot: OCRL Antibody (4A6) [H00004952-M02] - Analysis of OCRL over-expressed 293 cell line, cotransfected with OCRL Validated Chimera RNAi ( Cat # H00004952-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with OCRL monoclonal antibody (M02), clone 4A6 (Cat # H00004952-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: OCRL Antibody (4A6) [H00004952-M02] - OCRL monoclonal antibody (M02), clone 4A6 Analysis of OCRL expression in Hela S3 NE.](http://images.novusbio.com/fullsize/OCRL-Antibody-4A6-Western-Blot-H00004952-M02-img0010.jpg "Western Blot: OCRL Antibody (4A6) [H00004952-M02] - OCRL monoclonal antibody (M02), clone 4A6 Analysis of OCRL expression in Hela S3 NE.")
![Sandwich ELISA: OCRL Antibody (4A6) [H00004952-M02] - Detection limit for recombinant GST tagged OCRL is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/OCRL-Antibody-4A6-Sandwich-ELISA-H00004952-M02-img0009.jpg "Sandwich ELISA: OCRL Antibody (4A6) [H00004952-M02] - Detection limit for recombinant GST tagged OCRL is approximately 0.1ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
