NNT Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
Synthetic peptides corresponding to NNT(nicotinamide nucleotide transhydrogenase) The peptide sequence was selected from the N terminal of NNT.
Peptide sequence IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NNT |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
114 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for NNT Antibody
Background
NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. This gene encodes an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encoding the same protein, have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for NNT Antibody (NBP1-59612) (0)
There are no publications for NNT Antibody (NBP1-59612).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NNT Antibody (NBP1-59612) (0)
There are no reviews for NNT Antibody (NBP1-59612).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NNT Antibody (NBP1-59612) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NNT Products
Blogs on NNT