Home » Neurogenin-2 » Neurogenin-2 Proteins » Recombinant Human Neurogenin-2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Neurogenin-2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Neurogenin-2 Protein [H00063973-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Neurogenin-2 Protein [H00063973-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Neurogenin-2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-272 of Human NEUROG2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NEUROG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurogenin-2 GST (N-Term) Protein

  • Atoh4
  • BHLHA8
  • bHLHa8MGC46562
  • Class A basic helix-loop-helix protein 8
  • Math4A
  • NEUROG2
  • neurogenin 2
  • Neurogenin2
  • Neurogenin-2
  • NGN2
  • ngn-2
  • Protein atonal homolog 4

Background

Neurogenin-2 is a member of the neurogenin subfamily of basic helix-loop-helix (bHLH) transcription factor genes that play an important role in neurogenesis from migratory neural crest cells.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASCL1/Mash1
Antibody [Unconjugate
AF2567
Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
Neurogenin-1
Antibody (OTI3F9)
NBP1-47871
Immunocytochemistry/ Immunofluorescence Neurogenin-1 Antibody (OTI3F9)
Immunohistochemistry-Paraffin Neurogenin-1 Antibody (OTI3F9)
Immunohistochemistry-Paraffin Neurogenin-1 Antibody (OTI3F9)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NeuroD1 Antibody
[Unconjugated]
AF2746
Immunocytochemistry NeuroD1 Antibody [Unconjugated]
(18 Publications)
Species: Hu, Mu
Applications: ICC, WB
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Nurr1/NGFI-B
beta/NR4A2 Antibody [ ...
AF2156
Immunocytochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]
Immunohistochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]
(19 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(230 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
Olig2 Antibody
[Unconjugated]
AF2418
Chromatin Immunoprecipitation (ChIP) Olig2 Antibody [Unconjugated]
Immunocytochemistry Olig2 Antibody [Unconjugated]
Immunohistochemistry Olig2 Antibody [Unconjugated]
(2 Reviews)
(198 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ICC, IHC, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
ATOH7 Antibody
(1A5)
H00220202-M01
Western Blot ATOH7 Antibody (1A5)
(1 Publication)
Species: Hu
Applications: ELISA, WB
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
PITX3 Antibody
NBP2-85481
Western Blot PITX3 Antibody
Western Blot PITX3 Antibody
Western Blot PITX3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Islet-1 Antibody
[Unconjugated]
AF1837
Simple Western Islet-1 Antibody [Unconjugated]
Western Blot Islet-1 Antibody [Unconjugated]
Immunocytochemistry Islet-1 Antibody [Unconjugated]
(37 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Neogenin Antibody
[Unconjugated]
AF1079
Immunohistochemistry Neogenin Antibody [Unconjugated]
Western Blot Neogenin Antibody [Unconjugated]
Simple Western Neogenin Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu
Applications: Block, IHC, Simple Western, WB
Neurogenin-3
Antibody [Unconjugate
AF3444
Western Blot Neurogenin-3 Antibody [Unconjugated]
Immunohistochemistry Neurogenin-3 Antibody [Unconjugated]
(19 Publications)
Species: Hu
Applications: IHC, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(369 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(548 Publications)
Species: Hu
Applications: BA
LDB1 Antibody
NBP1-31362
Knockout Validated LDB1 Antibody
Immunohistochemistry-Paraffin LDB1 Antibody
Western Blot LDB1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB

Publications for Neurogenin-2 Recombinant Protein (H00063973-P01) (0)

There are no publications for Neurogenin-2 Recombinant Protein (H00063973-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurogenin-2 Recombinant Protein (H00063973-P01) (0)

There are no reviews for Neurogenin-2 Recombinant Protein (H00063973-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurogenin-2 Recombinant Protein (H00063973-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurogenin-2 Products

Research Areas for Neurogenin-2 Recombinant Protein (H00063973-P01)

Find related products by research area.

Blogs on Neurogenin-2

There are no specific blogs for Neurogenin-2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurogenin-2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NEUROG2