Home » NAV1 » NAV1 Proteins » NAV1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NAV1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NAV1 Protein (NBP1-84082PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NAV1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAV1.

Source: E. coli

Amino Acid Sequence: AKSFVKPPSLANLDKVNSNSLDLPSSSDTTHASKVPDLHATSSASGGPLPSCFTPSPAPILNINSASFSQGLELMSGFSVPKETRMYPKLSGLHRSMESLQMPMSLPSAFPSSTPVPTPPAPPAAPTEEETEELTWSGSP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84082.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NAV1 Recombinant Protein Antigen

  • FLJ12560
  • FLJ14203
  • KIAA1151POMFIL3DKFZp781D0314
  • KIAA1213
  • MGC14961
  • neuron navigator 1
  • neuron navigator-1
  • pore membrane and/or filament interacting like protein 3
  • Pore membrane and/or filament-interacting-like protein 3
  • STEERIN1
  • steerin-1
  • Unc-53 homolog 1
  • UNC53H1

Background

The NAV1 gene belongs to the neuron navigator family and is expressed predominantly in the nervous system. The encoded protein contains coiled-coil domains and a conserved AAA domain characteristic for ATPases associated with a variety of cellular activities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
SCN2A GST (N-Term) Pr ...
H00006326-Q01
Other Recombinant Human SCN2A GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Nav1.8 Antibody
(S134)
NBP1-47615
Immunohistochemistry Nav1.8 Antibody (S134)
Immunocytochemistry/ Immunofluorescence Nav1.8 Antibody (S134)
Immunocytochemistry/ Immunofluorescence Nav1.8 Antibody (S134)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NAV2 Antibody
NBP1-84615
Immunohistochemistry-Paraffin NAV2 Antibody
Immunocytochemistry/ Immunofluorescence NAV2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Dicer Antibody -
BSA Free
NBP1-71691
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Dicer Antibody - BSA Free
Immunohistochemistry Dicer Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
VGLUT1 Antibody
NBP3-13165
Immunohistochemistry-Paraffin VGLUT1 Antibody
Immunohistochemistry-Frozen VGLUT1 Antibody
Western Blot VGLUT1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
MCAT Antibody (2F2)
H00027349-M01
Immunohistochemistry-Paraffin MCAT Antibody (2F2)
Western Blot MCAT Antibody (2F2)
Sandwich ELISA MCAT Antibody (2F2)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Nav1.6 Antibody
NBP2-84177
Immunohistochemistry-Paraffin Nav1.6 Antibody
Immunohistochemistry-Paraffin Nav1.6 Antibody
Western Blot Nav1.6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Nucleostemin
Antibody [Unconjugate
AF1638
Immunocytochemistry Nucleostemin Antibody [Unconjugated]
Simple Western Nucleostemin Antibody [Unconjugated]
Western Blot Nucleostemin Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Dysbindin Antibody
NBP1-85299
Immunocytochemistry/ Immunofluorescence Dysbindin Antibody
Immunohistochemistry-Paraffin Dysbindin Antibody
Immunohistochemistry-Paraffin Dysbindin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RAPGEF3 Antibody -
BSA Free
NBP2-81767
Western Blot RAPGEF3 Antibody - BSA Free
Immunohistochemistry RAPGEF3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence RAPGEF3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
SCN11A Antibody
NBP1-82600
Immunohistochemistry-Paraffin SCN11A Antibody
Species: Hu
Applications: IHC, IHC-P
GAP-43 Antibody
NB300-143
Immunocytochemistry/ Immunofluorescence GAP-43 Antibody
Western Blot GAP-43 Antibody
Immunohistochemistry-Paraffin GAP-43 Antibody
(1 Review)
(101 Publications)
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
GRK2 Antibody
[Unconjugated]
AF4339
Western Blot GRK2 Antibody [Unconjugated]
Knockout Validated GRK2 Antibody [Unconjugated]
Immunohistochemistry GRK2 Antibody [Unconjugated]
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
VGLUT2 Antibody
(CL2952)
NBP2-46641
Immunohistochemistry-Paraffin VGLUT2 Antibody (CL2952)
Immunohistochemistry VGLUT2 Antibody (CL2952)
Immunohistochemistry VGLUT2 Antibody (CL2952)
(1 Publication)
Species: Hu, Mu, Rt, RM
Applications: IHC, IHC-Fr, IHC-P
NAV1 Recombinant
Protein Antigen
NBP1-84082PEP
NAV1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NAV1 Protein (NBP1-84082PEP) (0)

There are no publications for NAV1 Protein (NBP1-84082PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAV1 Protein (NBP1-84082PEP) (0)

There are no reviews for NAV1 Protein (NBP1-84082PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NAV1 Protein (NBP1-84082PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NAV1 Products

Array NBP1-84082PEP

Blogs on NAV1

There are no specific blogs for NAV1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: GAP-43 Antibody [NB300-143] - Cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to GAP43, dilution 1:2,000 in green, and costained with mouse mAb to vimentin, dilution 1:2,000, in red. Blue: DAPI staining of nuclear DNA. GAP43 antibody labels protein expressed in the axonal membrane of neuronal cells, while vimentin antibody stains intermediate filaments in fibroblasts and other non-neuronal cells.
GAP-43 Antibody
NB300-143

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NAV1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NAV1