MYO3A Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO3A. Source: E. coli
Amino Acid Sequence: IIIQSAARGHLVRKQRKEIVDMKNTAVTTIQTSDQEFDYKKNFENTRESFVKKQAENAISANERFISAPNNKGSVSVVKTSTFKPEEETTNAV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
MYO3A |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13636. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MYO3A Recombinant Protein Antigen
Background
MYO3A is encoded by this gene belongs to the myosin superfamily. Myosins are actin-dependent motor proteins and are categorized into conventional myosins (class II) and unconventional myosins (classes I and III through XV) based on their variable C-terminal cargo-binding domains. Class III myosins, such as this one, have a kinase domain N-terminal to the conserved N-terminal motor domains and are expressed in photoreceptors. The protein encoded by this gene plays an important role in hearing in humans. Three different recessive, loss of function mutations in the encoded protein have been shown to cause nonsyndromic progressive hearing loss. Expression of this gene is highly restricted, with the strongest expression in retina and cochlea.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: All-Multi
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ICC, IHC, KO, Simple Western, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: AC
Publications for MYO3A Protein (NBP2-13636PEP) (0)
There are no publications for MYO3A Protein (NBP2-13636PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MYO3A Protein (NBP2-13636PEP) (0)
There are no reviews for MYO3A Protein (NBP2-13636PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MYO3A Protein (NBP2-13636PEP) (0)
Additional MYO3A Products
Research Areas for MYO3A Protein (NBP2-13636PEP)
Find related products by research area.
|
Blogs on MYO3A